BLASTX nr result
ID: Angelica27_contig00026917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026917 (536 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252634.1 PREDICTED: outer envelope protein 80, chloroplast... 113 8e-26 >XP_017252634.1 PREDICTED: outer envelope protein 80, chloroplastic [Daucus carota subsp. sativus] XP_017252635.1 PREDICTED: outer envelope protein 80, chloroplastic [Daucus carota subsp. sativus] KZM95720.1 hypothetical protein DCAR_018962 [Daucus carota subsp. sativus] Length = 724 Score = 113 bits (282), Expect = 8e-26 Identities = 58/83 (69%), Positives = 64/83 (77%) Frame = +1 Query: 283 MPQNDGIRFMSSSIKIPCETIPQNDGIQFTSSSIKIPSFQSPXXXXXXXXXIISPFASVQ 462 MPQND IRF+SSSIKIPCET+PQ IQFT S+KI SF+S IISPFASVQ Sbjct: 1 MPQNDNIRFISSSIKIPCETMPQKADIQFTLPSMKISSFRSSHYLRRKHHHIISPFASVQ 60 Query: 463 LSNRNSVLQFVDSVKTPFTQLVE 531 SN NSVLQF+DSVKTPFTQLV+ Sbjct: 61 FSNHNSVLQFIDSVKTPFTQLVD 83