BLASTX nr result
ID: Angelica27_contig00026820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026820 (287 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08439.1 hypothetical protein DCAR_000985 [Daucus carota subsp... 55 6e-08 >KZN08439.1 hypothetical protein DCAR_000985 [Daucus carota subsp. sativus] Length = 106 Score = 55.5 bits (132), Expect = 6e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -3 Query: 237 SSNRSIIRGSIMMFRAPPRRQTVTRGRGPQTN 142 S++RSI GSIMMFRAPPRRQTVTRGRGPQTN Sbjct: 76 STSRSI-GGSIMMFRAPPRRQTVTRGRGPQTN 106