BLASTX nr result
ID: Angelica27_contig00026732
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026732 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249907.1 PREDICTED: polygalacturonase inhibitor-like [Dauc... 131 3e-35 APZ89677.1 AFP protein [Daucus carota] 123 4e-32 XP_017249729.1 PREDICTED: polygalacturonase inhibitor-like [Dauc... 120 5e-31 AFW20019.1 antifreeze protein [Daucus carota] 120 5e-31 AAV66074.1 antifreeze protein [Daucus carota] 120 5e-31 KZM93785.1 hypothetical protein DCAR_017030 [Daucus carota subsp... 109 7e-27 CBI29913.3 unnamed protein product, partial [Vitis vinifera] 92 3e-20 NP_001313444.1 polygalacturonase inhibitor-like precursor [Prunu... 92 3e-20 AFQ39767.1 polygalacturonase-inhibiting protein [Vitis labrusca ... 92 3e-20 AFQ39766.1 polygalacturonase-inhibiting protein [Vitis rupestris... 92 3e-20 AFQ39765.1 polygalacturonase-inhibiting protein [Vitis cinerea v... 92 3e-20 AEP27184.1 polygalacturonase-inhibiting protein 3 [Vitis thunber... 92 3e-20 AEP27183.1 polygalacturonase-inhibiting protein 2 [Vitis thunber... 92 3e-20 ABU82741.1 polygalacturonase-inhibiting protein [Vitis thunbergii] 92 3e-20 ACS16072.1 polygalacturonase-inhibiting protein [Vitis labrusca ... 92 3e-20 BAF95880.1 polygalacturonase inhibiting protein [Vitis hybrid cu... 92 3e-20 A7PW81.1 RecName: Full=Polygalacturonase inhibitor; AltName: Ful... 92 3e-20 AAM74142.1 polygalacturonase-inhibiting protein [Vitis vinifera] 92 3e-20 AAV33432.1 polygalacturonase inhibiting protein [Prunus mume] 92 4e-20 ACP28848.1 polygalacturonase-inhibiting protein [Vitis cinerea v... 92 4e-20 >XP_017249907.1 PREDICTED: polygalacturonase inhibitor-like [Daucus carota subsp. sativus] Length = 333 Score = 131 bits (329), Expect = 3e-35 Identities = 61/79 (77%), Positives = 66/79 (83%) Frame = +1 Query: 52 MKIESLSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDC 231 M IES SF PI CIC+ILLCLPN SASERCN NDKQ LL IK+A KNP+LLASWVP+EDC Sbjct: 1 MNIESSSFYPILCICMILLCLPNNSASERCNNNDKQVLLGIKEAFKNPHLLASWVPSEDC 60 Query: 232 CDWQLVECDETTNRINSLT 288 CDW LV+C ET NRI SLT Sbjct: 61 CDWYLVKCGETNNRIVSLT 79 >APZ89677.1 AFP protein [Daucus carota] Length = 332 Score = 123 bits (308), Expect = 4e-32 Identities = 58/78 (74%), Positives = 63/78 (80%) Frame = +1 Query: 52 MKIESLSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDC 231 M IES SF PI CIC+I LCLPNLSAS+RCN NDKQ LLQIK ALKNP + SWVP++DC Sbjct: 1 MNIES-SFCPILCICIISLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVPDDDC 59 Query: 232 CDWQLVECDETTNRINSL 285 C W LVECDET NRI SL Sbjct: 60 CGWNLVECDETNNRIISL 77 >XP_017249729.1 PREDICTED: polygalacturonase inhibitor-like [Daucus carota subsp. sativus] AAC62932.1 antifreeze protein [Daucus carota] CAB37347.1 antifreeze polypeptide [Daucus carota] KZM93784.1 hypothetical protein DCAR_017029 [Daucus carota subsp. sativus] Length = 332 Score = 120 bits (301), Expect = 5e-31 Identities = 57/78 (73%), Positives = 63/78 (80%) Frame = +1 Query: 52 MKIESLSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDC 231 M IES SF PI CIC+I LCLPNLSAS+RCN NDKQ LLQIK ALKNP + SWV ++DC Sbjct: 1 MNIES-SFCPILCICMIFLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVSDDDC 59 Query: 232 CDWQLVECDETTNRINSL 285 C W LVECDET+NRI SL Sbjct: 60 CGWDLVECDETSNRIISL 77 >AFW20019.1 antifreeze protein [Daucus carota] Length = 332 Score = 120 bits (301), Expect = 5e-31 Identities = 57/78 (73%), Positives = 63/78 (80%) Frame = +1 Query: 52 MKIESLSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDC 231 M IES SF PI CIC+I LCLPNLSAS+RCN NDKQ LLQIK ALKNP + SWV ++DC Sbjct: 1 MNIES-SFCPILCICMIFLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVSDDDC 59 Query: 232 CDWQLVECDETTNRINSL 285 C W LVECDET+NRI SL Sbjct: 60 CGWDLVECDETSNRIISL 77 >AAV66074.1 antifreeze protein [Daucus carota] Length = 332 Score = 120 bits (301), Expect = 5e-31 Identities = 57/78 (73%), Positives = 63/78 (80%) Frame = +1 Query: 52 MKIESLSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDC 231 M IES SF PI CIC+I LCLPNLSAS+RCN NDKQ LLQIK ALKNP + SWV ++DC Sbjct: 1 MNIES-SFCPILCICMIFLCLPNLSASQRCNNNDKQALLQIKTALKNPTITDSWVSDDDC 59 Query: 232 CDWQLVECDETTNRINSL 285 C W LVECDET+NRI SL Sbjct: 60 CGWDLVECDETSNRIISL 77 >KZM93785.1 hypothetical protein DCAR_017030 [Daucus carota subsp. sativus] Length = 318 Score = 109 bits (272), Expect = 7e-27 Identities = 50/64 (78%), Positives = 55/64 (85%) Frame = +1 Query: 97 VILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTNRI 276 +ILLCLPN SASERCN NDKQ LL IK+A KNP+LLASWVP+EDCCDW LV+C ET NRI Sbjct: 1 MILLCLPNNSASERCNNNDKQVLLGIKEAFKNPHLLASWVPSEDCCDWYLVKCGETNNRI 60 Query: 277 NSLT 288 SLT Sbjct: 61 VSLT 64 >CBI29913.3 unnamed protein product, partial [Vitis vinifera] Length = 320 Score = 92.0 bits (227), Expect = 3e-20 Identities = 43/66 (65%), Positives = 49/66 (74%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + V+L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC W VECD TT+ Sbjct: 14 LLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >NP_001313444.1 polygalacturonase inhibitor-like precursor [Prunus mume] AAW72619.1 polygalacturonase-inhibiting protein [Prunus mume] AAW72620.1 polygalacturonase-inhibiting protein [Prunus mume] Length = 330 Score = 92.0 bits (227), Expect = 3e-20 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +1 Query: 67 LSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQL 246 + F + C+ ++ + N + SE CNQ DK+ LLQIK+A +PY+L SW P DCCDW Sbjct: 3 VKFPTLLCLTLLFTAILNPALSELCNQEDKKVLLQIKKAFNDPYVLTSWKPETDCCDWYC 62 Query: 247 VECDETTNRINSLT 288 V CD TTNRINSLT Sbjct: 63 VTCDSTTNRINSLT 76 >AFQ39767.1 polygalacturonase-inhibiting protein [Vitis labrusca x Vitis riparia] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AFQ39766.1 polygalacturonase-inhibiting protein [Vitis rupestris x Vitis vinifera] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AFQ39765.1 polygalacturonase-inhibiting protein [Vitis cinerea var. helleri x Vitis riparia] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AEP27184.1 polygalacturonase-inhibiting protein 3 [Vitis thunbergii] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AEP27183.1 polygalacturonase-inhibiting protein 2 [Vitis thunbergii] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >ABU82741.1 polygalacturonase-inhibiting protein [Vitis thunbergii] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >ACS16072.1 polygalacturonase-inhibiting protein [Vitis labrusca x Vitis riparia] AFQ39768.1 polygalacturonase-inhibiting protein [Vitis labrusca] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >BAF95880.1 polygalacturonase inhibiting protein [Vitis hybrid cultivar] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 43/66 (65%), Positives = 49/66 (74%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + V+L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC W VECD TT+ Sbjct: 14 LLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >A7PW81.1 RecName: Full=Polygalacturonase inhibitor; AltName: Full=Polygalacturonase-inhibiting protein; Short=PGIG; Flags: Precursor AFQ39769.1 polygalacturonase-inhibiting protein [Vitis vinifera] AFQ39770.1 polygalacturonase-inhibiting protein [Vitis vinifera] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 43/66 (65%), Positives = 49/66 (74%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + V+L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC W VECD TT+ Sbjct: 14 LLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AAM74142.1 polygalacturonase-inhibiting protein [Vitis vinifera] Length = 333 Score = 92.0 bits (227), Expect = 3e-20 Identities = 43/66 (65%), Positives = 49/66 (74%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + V+L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC W VECD TT+ Sbjct: 14 LLVLLATRPCPSLSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCGWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79 >AAV33432.1 polygalacturonase inhibiting protein [Prunus mume] Length = 330 Score = 91.7 bits (226), Expect = 4e-20 Identities = 39/74 (52%), Positives = 50/74 (67%) Frame = +1 Query: 67 LSFSPIFCICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQL 246 + F + C+ ++ + N + SE CNQ DK+ LLQIK+A +PY+L SW P DCCDW Sbjct: 3 VKFPTLLCLTLLFSAILNPALSELCNQEDKKVLLQIKKAFNDPYVLTSWKPETDCCDWYC 62 Query: 247 VECDETTNRINSLT 288 V CD TTNRINSLT Sbjct: 63 VTCDSTTNRINSLT 76 >ACP28848.1 polygalacturonase-inhibiting protein [Vitis cinerea var. helleri x Vitis riparia] Length = 333 Score = 91.7 bits (226), Expect = 4e-20 Identities = 42/66 (63%), Positives = 50/66 (75%) Frame = +1 Query: 91 ICVILLCLPNLSASERCNQNDKQTLLQIKQALKNPYLLASWVPNEDCCDWQLVECDETTN 270 + ++L P S SERCN DK+ LLQIK+AL NPY+LASW PN DCC+W VECD TT+ Sbjct: 14 LLLLLATRPCPSFSERCNPKDKKVLLQIKKALDNPYILASWNPNTDCCEWYCVECDLTTH 73 Query: 271 RINSLT 288 RINSLT Sbjct: 74 RINSLT 79