BLASTX nr result
ID: Angelica27_contig00026705
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026705 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236979.1 PREDICTED: uncharacterized protein At5g39865 [Dau... 79 1e-15 KZN06515.1 hypothetical protein DCAR_007352 [Daucus carota subsp... 79 1e-15 >XP_017236979.1 PREDICTED: uncharacterized protein At5g39865 [Daucus carota subsp. sativus] Length = 254 Score = 78.6 bits (192), Expect = 1e-15 Identities = 41/67 (61%), Positives = 50/67 (74%), Gaps = 4/67 (5%) Frame = +1 Query: 34 MWRFREKASPK----INKLLSKNYSFKDIESLSDNHRSSAPAGKTPSIFHRIRRSNAVVR 201 MWRFREK P +NK LS++YSFKD+ESLSDN R SAP+ KT ++FHRIRRS+A R Sbjct: 1 MWRFREKIIPNSNKSLNKSLSQSYSFKDVESLSDNDRQSAPS-KTAAVFHRIRRSSAAFR 59 Query: 202 ALSTPNR 222 A S+ R Sbjct: 60 AFSSTTR 66 >KZN06515.1 hypothetical protein DCAR_007352 [Daucus carota subsp. sativus] Length = 264 Score = 78.6 bits (192), Expect = 1e-15 Identities = 41/67 (61%), Positives = 50/67 (74%), Gaps = 4/67 (5%) Frame = +1 Query: 34 MWRFREKASPK----INKLLSKNYSFKDIESLSDNHRSSAPAGKTPSIFHRIRRSNAVVR 201 MWRFREK P +NK LS++YSFKD+ESLSDN R SAP+ KT ++FHRIRRS+A R Sbjct: 1 MWRFREKIIPNSNKSLNKSLSQSYSFKDVESLSDNDRQSAPS-KTAAVFHRIRRSSAAFR 59 Query: 202 ALSTPNR 222 A S+ R Sbjct: 60 AFSSTTR 66