BLASTX nr result
ID: Angelica27_contig00026647
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026647 (395 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221031.1 PREDICTED: protein FAM136A-like [Daucus carota su... 62 2e-09 KZM85061.1 hypothetical protein DCAR_027517 [Daucus carota subsp... 62 8e-09 >XP_017221031.1 PREDICTED: protein FAM136A-like [Daucus carota subsp. sativus] XP_017221033.1 PREDICTED: protein FAM136A-like [Daucus carota subsp. sativus] Length = 154 Score = 62.0 bits (149), Expect = 2e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 393 ESCVDQSVQESINSLPFLVQKIKTSLSINDQSGSQ 289 ESCVDQSVQE+INSLPFLVQK+KTSLSIN+QS +Q Sbjct: 120 ESCVDQSVQENINSLPFLVQKMKTSLSINNQSDNQ 154 >KZM85061.1 hypothetical protein DCAR_027517 [Daucus carota subsp. sativus] Length = 296 Score = 62.0 bits (149), Expect = 8e-09 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = -3 Query: 393 ESCVDQSVQESINSLPFLVQKIKTSLSINDQSGSQ 289 ESCVDQSVQE+INSLPFLVQK+KTSLSIN+QS +Q Sbjct: 262 ESCVDQSVQENINSLPFLVQKMKTSLSINNQSDNQ 296