BLASTX nr result
ID: Angelica27_contig00026584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026584 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230782.1 PREDICTED: cold-inducible RNA-binding protein-lik... 63 1e-09 KZN08220.1 hypothetical protein DCAR_001285 [Daucus carota subsp... 63 2e-09 >XP_017230782.1 PREDICTED: cold-inducible RNA-binding protein-like isoform X1 [Daucus carota subsp. sativus] Length = 146 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 462 YVDGRLIYVELAKLDKRSYYRPPITSGPPTEQVMST 355 YVDGRLIYV+LAKLDK SYYRPPITSGPP ++ +T Sbjct: 104 YVDGRLIYVDLAKLDKHSYYRPPITSGPPEGKMTAT 139 >KZN08220.1 hypothetical protein DCAR_001285 [Daucus carota subsp. sativus] Length = 167 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 462 YVDGRLIYVELAKLDKRSYYRPPITSGPPTEQVMST 355 YVDGRLIYV+LAKLDK SYYRPPITSGPP ++ +T Sbjct: 125 YVDGRLIYVDLAKLDKHSYYRPPITSGPPEGKMTAT 160