BLASTX nr result
ID: Angelica27_contig00026237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026237 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017240730.1 PREDICTED: serine/threonine-protein kinase 38-lik... 63 7e-10 >XP_017240730.1 PREDICTED: serine/threonine-protein kinase 38-like [Daucus carota subsp. sativus] KZN03802.1 hypothetical protein DCAR_012558 [Daucus carota subsp. sativus] Length = 556 Score = 62.8 bits (151), Expect = 7e-10 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +1 Query: 70 MDSA--WLHKFQPRERMKSSTKNKKSGVSEDDENKEAT 177 MDSA WLHKFQPRER++SS KNK+SGV EDDENKE T Sbjct: 1 MDSARGWLHKFQPRERIRSSAKNKRSGVPEDDENKEET 38