BLASTX nr result
ID: Angelica27_contig00026050
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026050 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87347.1 hypothetical protein DCAR_024481 [Daucus carota subsp... 55 2e-07 >KZM87347.1 hypothetical protein DCAR_024481 [Daucus carota subsp. sativus] Length = 91 Score = 55.1 bits (131), Expect = 2e-07 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 301 TQLDFTEPEILDLDSVFKPGRV--WIWI*GIPIQTRPEIQNPIQIRS 167 T++D TEP+ILDLD +F+P RV WIWI GIP + NPIQ R+ Sbjct: 15 TRIDLTEPDILDLDLIFRPERVWIWIWILGIPFRNPTRNPNPIQTRN 61