BLASTX nr result
ID: Angelica27_contig00026000
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00026000 (236 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN01000.1 hypothetical protein DCAR_009754 [Daucus carota subsp... 75 6e-14 XP_017242118.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 75 6e-14 JAU10277.1 26S proteasome non-ATPase regulatory subunit 2 -like ... 68 2e-13 JAU83203.1 26S proteasome non-ATPase regulatory subunit 2 -like ... 67 6e-13 JAU32078.1 26S proteasome non-ATPase regulatory subunit 2 -like ... 67 7e-13 JAU61895.1 26S proteasome non-ATPase regulatory subunit 2 -like ... 67 1e-12 XP_010526503.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 71 1e-12 KDO49595.1 hypothetical protein CISIN_1g0026962mg, partial [Citr... 68 2e-12 OIW08347.1 hypothetical protein TanjilG_03023 [Lupinus angustifo... 70 4e-12 XP_019449040.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 70 4e-12 XP_019453694.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 70 4e-12 XP_019453693.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 70 4e-12 NP_565477.1 26S proteasome regulatory subunit S2 1A [Arabidopsis... 70 4e-12 XP_015881444.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 70 4e-12 XP_006412950.1 hypothetical protein EUTSA_v10024363mg [Eutrema s... 69 5e-12 XP_018484254.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 69 5e-12 XP_013738232.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 69 5e-12 XP_013598567.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 69 5e-12 XP_009137786.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 69 5e-12 XP_013706716.1 PREDICTED: 26S proteasome non-ATPase regulatory s... 69 5e-12 >KZN01000.1 hypothetical protein DCAR_009754 [Daucus carota subsp. sativus] Length = 866 Score = 74.7 bits (182), Expect = 6e-14 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DIGYMIYMKFE+YPRALQIALF DNMQYV Sbjct: 206 KYLPGPDDVLVLDIGYMIYMKFEEYPRALQIALFLDNMQYV 246 >XP_017242118.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Daucus carota subsp. sativus] Length = 889 Score = 74.7 bits (182), Expect = 6e-14 Identities = 33/41 (80%), Positives = 38/41 (92%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DIGYMIYMKFE+YPRALQIALF DNMQYV Sbjct: 229 KYLPGPDDVLVLDIGYMIYMKFEEYPRALQIALFLDNMQYV 269 >JAU10277.1 26S proteasome non-ATPase regulatory subunit 2 -like protein A, partial [Noccaea caerulescens] Length = 86 Score = 68.2 bits (165), Expect = 2e-13 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIYMKFE+YP ALQIALF DN QY+ Sbjct: 27 KYLPGPDDMLVLDISYMIYMKFEEYPNALQIALFLDNTQYI 67 >JAU83203.1 26S proteasome non-ATPase regulatory subunit 2 -like protein B, partial [Noccaea caerulescens] Length = 86 Score = 67.0 bits (162), Expect = 6e-13 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KF +YP ALQIALF DNMQYV Sbjct: 27 KYLPGPDDMLVLDIAYMIYIKFAEYPNALQIALFLDNMQYV 67 >JAU32078.1 26S proteasome non-ATPase regulatory subunit 2 -like protein B, partial [Noccaea caerulescens] Length = 90 Score = 67.0 bits (162), Expect = 7e-13 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KF +YP ALQIALF DNMQYV Sbjct: 31 KYLPGPDDMLVLDIAYMIYIKFAEYPNALQIALFLDNMQYV 71 >JAU61895.1 26S proteasome non-ATPase regulatory subunit 2 -like protein B, partial [Noccaea caerulescens] Length = 105 Score = 67.0 bits (162), Expect = 1e-12 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KF +YP ALQIALF DNMQYV Sbjct: 46 KYLPGPDDMLVLDIAYMIYIKFAEYPNALQIALFLDNMQYV 86 >XP_010526503.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Tarenaya hassleriana] Length = 891 Score = 70.9 bits (172), Expect = 1e-12 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIYMKFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYMKFEEYPNALQIALFLDNMQYV 273 >KDO49595.1 hypothetical protein CISIN_1g0026962mg, partial [Citrus sinensis] Length = 170 Score = 68.2 bits (165), Expect = 2e-12 Identities = 29/41 (70%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE++P ALQIALF DNMQYV Sbjct: 54 KYLPGPDDMLVLDIAYMIYLKFEEFPNALQIALFLDNMQYV 94 >OIW08347.1 hypothetical protein TanjilG_03023 [Lupinus angustifolius] Length = 804 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI Y+IY+KFE+YP ALQIALF DNMQYV Sbjct: 145 RYLPGPDDMLVLDIAYLIYLKFEEYPNALQIALFLDNMQYV 185 >XP_019449040.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Lupinus angustifolius] Length = 887 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI Y+IY+KFE+YP ALQIALF DNMQYV Sbjct: 228 RYLPGPDDMLVLDIAYLIYLKFEEYPNALQIALFLDNMQYV 268 >XP_019453694.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like isoform X2 [Lupinus angustifolius] XP_019453695.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like isoform X3 [Lupinus angustifolius] OIW06001.1 hypothetical protein TanjilG_11688 [Lupinus angustifolius] Length = 887 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI Y+IY+KFE+YP ALQIALF DNMQYV Sbjct: 228 RYLPGPDDMLVLDIAYLIYLKFEEYPNALQIALFLDNMQYV 268 >XP_019453693.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like isoform X1 [Lupinus angustifolius] Length = 888 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI Y+IY+KFE+YP ALQIALF DNMQYV Sbjct: 229 RYLPGPDDMLVLDIAYLIYLKFEEYPNALQIALFLDNMQYV 269 >NP_565477.1 26S proteasome regulatory subunit S2 1A [Arabidopsis thaliana] Q9SIV2.2 RecName: Full=26S proteasome non-ATPase regulatory subunit 2 homolog A; AltName: Full=26S proteasome regulatory subunit RPN1a; Short=AtRPN1a; AltName: Full=26S proteasome regulatory subunit S2 homolog A AAK25926.1 putative 26S proteasome regulatory subunit S2 [Arabidopsis thaliana] AAK64119.1 putative 26S proteasome regulatory subunit S2 [Arabidopsis thaliana] AAD21708.2 26S proteasome regulatory subunit S2 (RPN1) [Arabidopsis thaliana] AAP86655.1 26S proteasome subunit RPN1a [Arabidopsis thaliana] AEC07032.1 26S proteasome regulatory subunit S2 1A [Arabidopsis thaliana] OAP11627.1 RPN1A [Arabidopsis thaliana] Length = 891 Score = 69.7 bits (169), Expect = 4e-12 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI YMIYMKFE+YP ALQIALF DN QYV Sbjct: 233 RYLPGPDDMLVLDISYMIYMKFEEYPNALQIALFLDNTQYV 273 >XP_015881444.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A [Ziziphus jujuba] Length = 895 Score = 69.7 bits (169), Expect = 4e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 RY PGP+D+ V+DI YMIY+KFE+YP ALQIALF DN+QYV Sbjct: 235 RYLPGPDDMLVLDIAYMIYLKFEEYPNALQIALFLDNLQYV 275 >XP_006412950.1 hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] ESQ54403.1 hypothetical protein EUTSA_v10024363mg [Eutrema salsugineum] Length = 746 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273 >XP_018484254.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog B [Raphanus sativus] Length = 891 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273 >XP_013738232.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Brassica napus] Length = 891 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273 >XP_013598567.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog B [Brassica oleracea var. oleracea] Length = 891 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273 >XP_009137786.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog A-like [Brassica rapa] Length = 891 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273 >XP_013706716.1 PREDICTED: 26S proteasome non-ATPase regulatory subunit 2 homolog B-like [Brassica napus] CDX92875.1 BnaC07g41330D [Brassica napus] Length = 891 Score = 69.3 bits (168), Expect = 5e-12 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 RYRPGPEDLQVVDIGYMIYMKFEDYPRALQIALFRDNMQYV 3 +Y PGP+D+ V+DI YMIY+KFE+YP ALQIALF DNMQYV Sbjct: 233 KYLPGPDDMLVLDIAYMIYIKFEEYPNALQIALFLDNMQYV 273