BLASTX nr result
ID: Angelica27_contig00025956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025956 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN08708.1 hypothetical protein DCAR_001364 [Daucus carota subsp... 67 4e-12 XP_017232467.1 PREDICTED: cell wall / vacuolar inhibitor of fruc... 67 1e-11 XP_017237608.1 PREDICTED: cell wall / vacuolar inhibitor of fruc... 52 3e-06 >KZN08708.1 hypothetical protein DCAR_001364 [Daucus carota subsp. sativus] Length = 187 Score = 67.0 bits (162), Expect = 4e-12 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +1 Query: 88 VMANFQYFLVLLISISFTHFFHQPFPFVNGDTDLIQRTCKTT 213 +MA+F Y L+LL+SI F HFFHQPF FVNGDTDLIQ+TCKTT Sbjct: 1 MMAHFLY-LLLLVSIWFPHFFHQPFLFVNGDTDLIQKTCKTT 41 >XP_017232467.1 PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2 [Daucus carota subsp. sativus] Length = 258 Score = 67.0 bits (162), Expect = 1e-11 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +1 Query: 88 VMANFQYFLVLLISISFTHFFHQPFPFVNGDTDLIQRTCKTT 213 +MA+F Y L+LL+SI F HFFHQPF FVNGDTDLIQ+TCKTT Sbjct: 1 MMAHFLY-LLLLVSIWFPHFFHQPFLFVNGDTDLIQKTCKTT 41 >XP_017237608.1 PREDICTED: cell wall / vacuolar inhibitor of fructosidase 2-like [Daucus carota subsp. sativus] Length = 189 Score = 51.6 bits (122), Expect = 3e-06 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%) Frame = +1 Query: 91 MANFQYFLVLLI-SISFTHFFHQPFPFVNGDTDLIQRTCKTT 213 M F Y ++LL+ S T F QPF FVNGDTD IQ+TC+TT Sbjct: 1 MGKFVYLMLLLVLPASLTELFQQPFCFVNGDTDFIQKTCRTT 42