BLASTX nr result
ID: Angelica27_contig00025833
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025833 (601 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017250791.1 PREDICTED: pentatricopeptide repeat-containing pr... 106 1e-23 KZM94145.1 hypothetical protein DCAR_017390 [Daucus carota subsp... 106 3e-23 CAN72397.1 hypothetical protein VITISV_041201 [Vitis vinifera] 62 1e-07 XP_019075855.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-07 KVH90937.1 Pentatricopeptide repeat-containing protein [Cynara c... 60 4e-07 EEF38963.1 pentatricopeptide repeat-containing protein, putative... 59 1e-06 XP_015577407.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 1e-06 XP_010257813.2 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 CBI41082.3 unnamed protein product, partial [Vitis vinifera] 57 2e-06 XP_002270940.2 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-06 EOY23397.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 57 5e-06 XP_007038898.2 PREDICTED: putative pentatricopeptide repeat-cont... 57 5e-06 EOY23398.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 57 5e-06 XP_003550993.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 7e-06 >XP_017250791.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Daucus carota subsp. sativus] Length = 425 Score = 106 bits (264), Expect = 1e-23 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 TRNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQFNSEATEDF 182 TRNMMR GV+K+AGGSCI+VNNRL+EF+AGDRSHPQ+ IIYNLLH+VYGQFN EAT+ F Sbjct: 365 TRNMMRDTGVKKVAGGSCIEVNNRLNEFIAGDRSHPQADIIYNLLHVVYGQFNIEATDVF 424 Query: 183 D 185 D Sbjct: 425 D 425 >KZM94145.1 hypothetical protein DCAR_017390 [Daucus carota subsp. sativus] Length = 525 Score = 106 bits (264), Expect = 3e-23 Identities = 48/61 (78%), Positives = 56/61 (91%) Frame = +3 Query: 3 TRNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQFNSEATEDF 182 TRNMMR GV+K+AGGSCI+VNNRL+EF+AGDRSHPQ+ IIYNLLH+VYGQFN EAT+ F Sbjct: 465 TRNMMRDTGVKKVAGGSCIEVNNRLNEFIAGDRSHPQADIIYNLLHVVYGQFNIEATDVF 524 Query: 183 D 185 D Sbjct: 525 D 525 >CAN72397.1 hypothetical protein VITISV_041201 [Vitis vinifera] Length = 576 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLL 137 R +MR GV+K+ GGSCI+VNNR+ EFVAGD+ HPQS+ I+ +L Sbjct: 497 RKVMRDTGVKKMPGGSCIEVNNRVHEFVAGDKLHPQSERIFEVL 540 >XP_019075855.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Vitis vinifera] Length = 576 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/44 (61%), Positives = 36/44 (81%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLL 137 R +MR GV+K+ GGSCI+VNNR+ EFVAGD+ HPQS+ I+ +L Sbjct: 497 RKVMRDTGVKKMPGGSCIEVNNRVHEFVAGDKLHPQSERIFEVL 540 >KVH90937.1 Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 558 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/45 (55%), Positives = 39/45 (86%) Frame = +3 Query: 3 TRNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLL 137 TR +MR IGV+K++G SCI++N+R+ EF++G+RSHPQS+ I+ +L Sbjct: 483 TRKVMRDIGVKKMSGVSCIELNSRVHEFISGNRSHPQSERIFEVL 527 >EEF38963.1 pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 538 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQ 155 R MMR GV+KI GGS I+VNNR++EF+AG+ SHPQ IY +++ + Q Sbjct: 469 RKMMRDRGVKKIPGGSFIEVNNRVNEFIAGETSHPQFDEIYEVIYKINEQ 518 >XP_015577407.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] XP_015577408.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] XP_015577409.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] XP_002523384.2 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] Length = 556 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/50 (54%), Positives = 37/50 (74%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQ 155 R MMR GV+KI GGS I+VNNR++EF+AG+ SHPQ IY +++ + Q Sbjct: 487 RKMMRDRGVKKIPGGSFIEVNNRVNEFIAGETSHPQFDEIYEVIYKINEQ 536 >XP_010257813.2 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Nelumbo nucifera] Length = 384 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/43 (62%), Positives = 35/43 (81%) Frame = +3 Query: 12 MMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLH 140 MMR V+K+ GGS I+VNNR+ EFVAGD+SHPQS+ IY +L+ Sbjct: 317 MMRXKXVKKMPGGSSIEVNNRVHEFVAGDKSHPQSEWIYKVLY 359 >CBI41082.3 unnamed protein product, partial [Vitis vinifera] Length = 413 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 8/70 (11%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLV--------YGQFN 161 R MM++I +QK+ G S I+V+N + EFVAGD+SHP+SK I +L + Y Sbjct: 267 RRMMKNINIQKVPGSSSIEVDNAVHEFVAGDQSHPESKKILRMLSEITARLKANGYAPLT 326 Query: 162 SEATEDFD*K 191 + +DFD K Sbjct: 327 ASVLQDFDEK 336 >XP_002270940.2 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Vitis vinifera] Length = 640 Score = 57.4 bits (137), Expect = 3e-06 Identities = 29/70 (41%), Positives = 42/70 (60%), Gaps = 8/70 (11%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLV--------YGQFN 161 R MM++I +QK+ G S I+V+N + EFVAGD+SHP+SK I +L + Y Sbjct: 494 RRMMKNINIQKVPGSSSIEVDNAVHEFVAGDQSHPESKKILRMLSEITARLKANGYAPLT 553 Query: 162 SEATEDFD*K 191 + +DFD K Sbjct: 554 ASVLQDFDEK 563 >EOY23397.1 Tetratricopeptide repeat (TPR)-like superfamily protein, putative [Theobroma cacao] Length = 587 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQ 155 R++M+S G++K+AGGS ++NN++ F+AGDRSHP SK IY L ++ G+ Sbjct: 209 RSIMKSKGIKKMAGGSNTEINNQVYTFLAGDRSHPPSKSIYEELDVLVGE 258 >XP_007038898.2 PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Theobroma cacao] XP_017972918.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g49142 [Theobroma cacao] Length = 677 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQ 155 R++M+S G++K+AG S ++NN++ F+AGDRSHPQSK IY L ++ G+ Sbjct: 531 RSIMKSKGIKKMAGASNTEINNQVYTFLAGDRSHPQSKAIYEELDVLVGK 580 >EOY23398.1 Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] EOY23399.1 Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 677 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/50 (50%), Positives = 39/50 (78%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYGQ 155 R++M+S G++K+AG S ++NN++ F+AGDRSHPQSK IY L ++ G+ Sbjct: 531 RSIMKSKGIKKMAGASNTEINNQVYTFLAGDRSHPQSKAIYEELDVLVGK 580 >XP_003550993.1 PREDICTED: pentatricopeptide repeat-containing protein ELI1, chloroplastic [Glycine max] KRH04499.1 hypothetical protein GLYMA_17G165800 [Glycine max] Length = 628 Score = 56.2 bits (134), Expect = 7e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 6 RNMMRSIGVQKIAGGSCIDVNNRLDEFVAGDRSHPQSKIIYNLLHLVYG 152 R+MM+ GV+K G S I+V NR+ EFVAGDR HP+SK IY++L + G Sbjct: 482 RSMMKGSGVEKEPGCSSIEVKNRVHEFVAGDRRHPRSKDIYSMLEKMNG 530