BLASTX nr result
ID: Angelica27_contig00025824
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025824 (293 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002442648.1 hypothetical protein SORBIDRAFT_08g000465 [Sorghu... 77 1e-15 ONK77051.1 uncharacterized protein A4U43_C02F2590 [Asparagus off... 79 1e-15 XP_015088651.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 79 2e-15 NP_001234270.2 GRX1 protein [Solanum lycopersicum] 79 2e-15 CBI83380.1 SlGRX1 protein [Solanum lycopersicum] 79 2e-15 GAU50938.1 hypothetical protein TSUD_411350 [Trifolium subterran... 77 2e-15 XP_006366945.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 79 2e-15 XP_016541912.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 79 2e-15 GAU51307.1 hypothetical protein TSUD_412670, partial [Trifolium ... 76 2e-15 XP_018831954.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 75 2e-15 GAU50161.1 hypothetical protein TSUD_263400 [Trifolium subterran... 76 3e-15 GAU51043.1 hypothetical protein TSUD_411750 [Trifolium subterran... 76 3e-15 GAU51309.1 hypothetical protein TSUD_412690 [Trifolium subterran... 76 3e-15 WP_042697386.1 MULTISPECIES: monothiol glutaredoxin, Grx4 family... 74 3e-15 WP_012973286.1 monothiol glutaredoxin, Grx4 family [Azospirillum... 74 3e-15 WP_014246973.1 monothiol glutaredoxin, Grx4 family [Azospirillum... 74 3e-15 XP_019238990.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 78 3e-15 XP_009621207.1 PREDICTED: bifunctional monothiol glutaredoxin-S1... 78 3e-15 XP_010104252.1 Monothiol glutaredoxin-S16 [Morus notabilis] EXB9... 78 3e-15 WP_045581878.1 monothiol glutaredoxin, Grx4 family [Azospirillum... 74 3e-15 >XP_002442648.1 hypothetical protein SORBIDRAFT_08g000465 [Sorghum bicolor] EES16486.1 hypothetical protein SORBI_008G003400 [Sorghum bicolor] Length = 147 Score = 76.6 bits (187), Expect = 1e-15 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFE 150 HN GLRE LK YS WPTFPQ+F+ GELVGG DI++ M+EKGEL LF+ Sbjct: 99 HNHGLRETLKTYSNWPTFPQIFIGGELVGGCDIISSMAEKGELAALFQ 146 >ONK77051.1 uncharacterized protein A4U43_C02F2590 [Asparagus officinalis] Length = 296 Score = 79.3 bits (194), Expect = 1e-15 Identities = 35/48 (72%), Positives = 41/48 (85%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFE 150 +NPGLRE LK YS WPTFPQVFVKGEL+GG DI++ M+EKGEL LF+ Sbjct: 248 YNPGLRETLKKYSNWPTFPQVFVKGELLGGCDIISAMAEKGELATLFK 295 >XP_015088651.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic [Solanum pennellii] Length = 292 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 244 YNSGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELASLFKS 292 >NP_001234270.2 GRX1 protein [Solanum lycopersicum] Length = 292 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 244 YNSGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELASLFKS 292 >CBI83380.1 SlGRX1 protein [Solanum lycopersicum] Length = 292 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 244 YNSGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELASLFKS 292 >GAU50938.1 hypothetical protein TSUD_411350 [Trifolium subterraneum] Length = 169 Score = 76.6 bits (187), Expect = 2e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+F+ GELVGG DILT M EKGE+ LF+N Sbjct: 121 YNYGLRETLKQYSNWPTFPQIFLNGELVGGCDILTSMFEKGEVASLFKN 169 >XP_006366945.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic [Solanum tuberosum] Length = 296 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 248 YNSGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELASLFKS 296 >XP_016541912.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic [Capsicum annuum] Length = 320 Score = 79.0 bits (193), Expect = 2e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 272 YNAGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELASLFKS 320 >GAU51307.1 hypothetical protein TSUD_412670, partial [Trifolium subterraneum] Length = 167 Score = 76.3 bits (186), Expect = 2e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+F+ GELVGG DILT M EKGE+ LF+N Sbjct: 119 YNYGLRETLKQYSNWPTFPQIFLNGELVGGCDILTSMFEKGEIAGLFKN 167 >XP_018831954.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic-like, partial [Juglans regia] Length = 127 Score = 75.1 bits (183), Expect = 2e-15 Identities = 34/48 (70%), Positives = 37/48 (77%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFE 150 +N GLRE LK YS WPTFPQ+FV GELVGG DILT M EKGEL F+ Sbjct: 79 YNNGLRETLKKYSNWPTFPQIFVNGELVGGCDILTSMYEKGELASFFK 126 >GAU50161.1 hypothetical protein TSUD_263400 [Trifolium subterraneum] Length = 169 Score = 75.9 bits (185), Expect = 3e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+F+ GELVGG DILT M EKGE+ LF+N Sbjct: 121 YNYGLRETLKQYSNWPTFPQIFLNGELVGGCDILTSMFEKGEVAGLFKN 169 >GAU51043.1 hypothetical protein TSUD_411750 [Trifolium subterraneum] Length = 169 Score = 75.9 bits (185), Expect = 3e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+F+ GELVGG DILT M EKGE+ LF+N Sbjct: 121 YNYGLRETLKQYSNWPTFPQIFLNGELVGGCDILTSMFEKGEVAGLFKN 169 >GAU51309.1 hypothetical protein TSUD_412690 [Trifolium subterraneum] Length = 169 Score = 75.9 bits (185), Expect = 3e-15 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+F+ GELVGG DILT M EKGE+ LF+N Sbjct: 121 YNYGLRETLKQYSNWPTFPQIFLNGELVGGCDILTSMFEKGEVAGLFKN 169 >WP_042697386.1 MULTISPECIES: monothiol glutaredoxin, Grx4 family [Azospirillum] ANC90818.1 monothiol glutaredoxin, Grx4 family [Azospirillum humicireducens] Length = 111 Score = 74.3 bits (181), Expect = 3e-15 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -1 Query: 290 NPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFENKG 141 +PGLR+ LK YS WPTFPQ++VKGELVGG DI+ EM E GEL+ L +KG Sbjct: 57 DPGLRQGLKEYSNWPTFPQLYVKGELVGGCDIVREMYESGELQTLLADKG 106 >WP_012973286.1 monothiol glutaredoxin, Grx4 family [Azospirillum lipoferum] BAI71300.1 monothiol glutaredoxin [Azospirillum sp. B510] Length = 111 Score = 74.3 bits (181), Expect = 3e-15 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -1 Query: 290 NPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFENKG 141 +PGLR+ LK YS WPTFPQ++VKGELVGG DI+ EM E GEL+ L +KG Sbjct: 57 DPGLRQGLKEYSNWPTFPQLYVKGELVGGCDIVREMYESGELQALLADKG 106 >WP_014246973.1 monothiol glutaredoxin, Grx4 family [Azospirillum lipoferum] CBS85923.1 monothiol glutaredoxin [Azospirillum lipoferum 4B] Length = 111 Score = 74.3 bits (181), Expect = 3e-15 Identities = 33/50 (66%), Positives = 40/50 (80%) Frame = -1 Query: 290 NPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFENKG 141 +PGLR+ LK YS WPTFPQ++VKGELVGG DI+ EM E GEL+ L +KG Sbjct: 57 DPGLRQGLKEYSNWPTFPQLYVKGELVGGCDIVREMYESGELQTLLADKG 106 >XP_019238990.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic [Nicotiana attenuata] OIT21347.1 bifunctional monothiol glutaredoxin-s16, chloroplastic [Nicotiana attenuata] Length = 298 Score = 78.2 bits (191), Expect = 3e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 250 YNYGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELTNLFKS 298 >XP_009621207.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic [Nicotiana tomentosiformis] XP_016432326.1 PREDICTED: bifunctional monothiol glutaredoxin-S16, chloroplastic-like [Nicotiana tabacum] Length = 298 Score = 78.2 bits (191), Expect = 3e-15 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFEN 147 +N GLRE LK YS WPTFPQ+FVKGELVGG DILT M EKGEL LF++ Sbjct: 250 YNYGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEKGELANLFKS 298 >XP_010104252.1 Monothiol glutaredoxin-S16 [Morus notabilis] EXB99419.1 Monothiol glutaredoxin-S16 [Morus notabilis] Length = 299 Score = 78.2 bits (191), Expect = 3e-15 Identities = 36/48 (75%), Positives = 39/48 (81%) Frame = -1 Query: 293 HNPGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFE 150 HN GLRE LK YS WPTFPQ+FV GELVGG DILT M+EKGEL LF+ Sbjct: 251 HNFGLRETLKRYSNWPTFPQIFVGGELVGGCDILTSMNEKGELGSLFK 298 >WP_045581878.1 monothiol glutaredoxin, Grx4 family [Azospirillum thiophilum] KJR66578.1 glutaredoxin [Azospirillum thiophilum] ALG69738.1 glutaredoxin [Azospirillum thiophilum] Length = 113 Score = 74.3 bits (181), Expect = 3e-15 Identities = 33/49 (67%), Positives = 39/49 (79%) Frame = -1 Query: 287 PGLREALKMYSGWPTFPQVFVKGELVGGADILTEMSEKGELRKLFENKG 141 PGLR+ LK YS WPTFPQ++VKGELVGG DI+ EM E GEL+ L +KG Sbjct: 58 PGLRQGLKEYSNWPTFPQLYVKGELVGGCDIVREMYESGELQSLMADKG 106