BLASTX nr result
ID: Angelica27_contig00025785
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025785 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238371.1 PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 5,... 75 2e-15 KCW66302.1 hypothetical protein EUGRSUZ_F00127 [Eucalyptus grandis] 57 8e-08 >XP_017238371.1 PREDICTED: protein TRIGALACTOSYLDIACYLGLYCEROL 5, chloroplastic [Daucus carota subsp. sativus] KZN00093.1 hypothetical protein DCAR_008847 [Daucus carota subsp. sativus] Length = 96 Score = 75.1 bits (183), Expect = 2e-15 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = -1 Query: 246 SQYRSSRLTFQGMEFNKNSVDQDKDLDITKSTLKAGSK 133 SQYRSS+LTFQGMEFNKNSVDQDKDLDITKST KAGSK Sbjct: 59 SQYRSSKLTFQGMEFNKNSVDQDKDLDITKSTFKAGSK 96 >KCW66302.1 hypothetical protein EUGRSUZ_F00127 [Eucalyptus grandis] Length = 152 Score = 56.6 bits (135), Expect = 8e-08 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = -3 Query: 319 PGSWCRWRVWSWARPRMGIWHWIW*PISVFQTHISGHGV 203 PG WCRWR+WS RP MGIWH +W +SV +I H + Sbjct: 61 PGPWCRWRLWSRIRPWMGIWHCLWKSVSVIHINIPRHRI 99