BLASTX nr result
ID: Angelica27_contig00025755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025755 (613 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221418.1 PREDICTED: transcription initiation factor TFIID ... 59 2e-13 >XP_017221418.1 PREDICTED: transcription initiation factor TFIID subunit 4-like [Daucus carota subsp. sativus] KZN09024.1 hypothetical protein DCAR_001680 [Daucus carota subsp. sativus] Length = 292 Score = 59.3 bits (142), Expect(2) = 2e-13 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = -3 Query: 272 FQRCYCLCENDLEEEQEQLFSKAAENKVSTSLQRGQYSLHQEEEMLYQKLFLRAKLKSI 96 F + E +LE+E+EQLFSK A NKVS + Q +YS+ QE+EM K FLRAKL++I Sbjct: 38 FSDVTAIAEINLEDEREQLFSKTAGNKVSATPQDHRYSVGQEDEMFLSKTFLRAKLENI 96 Score = 43.9 bits (102), Expect(2) = 2e-13 Identities = 23/36 (63%), Positives = 24/36 (66%) Frame = -2 Query: 483 MAPKICFSKEDLLKEFDLSMQVQRYVQLSCFVHLLE 376 M PK C SKEDL KEFDLSMQ+QR Q S H E Sbjct: 1 MGPKRCNSKEDLFKEFDLSMQMQRKRQKSSGCHQAE 36