BLASTX nr result
ID: Angelica27_contig00025269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025269 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_011088100.1 PREDICTED: MFS18 protein-like [Sesamum indicum] 60 3e-09 KZV54449.1 hypothetical protein F511_09764 [Dorcoceras hygrometr... 52 1e-06 >XP_011088100.1 PREDICTED: MFS18 protein-like [Sesamum indicum] Length = 120 Score = 60.1 bits (144), Expect = 3e-09 Identities = 34/69 (49%), Positives = 42/69 (60%), Gaps = 5/69 (7%) Frame = +2 Query: 53 EQVDEPENYSGSFSGTLPGPFTG---TYQSPGYTLDFPSPGLPTGTLPSPSVGSGSPT-- 217 E VD+P+ + GSF GT P PF G ++ G FP GL G+LP+PS+GSGS T Sbjct: 35 EVVDQPQTF-GSFGGTFPAPFPGLGGSFPGSGLGGSFPGTGLG-GSLPNPSMGSGSSTSS 92 Query: 218 LCGFPGVMC 244 C FPGV C Sbjct: 93 FCSFPGVRC 101 >KZV54449.1 hypothetical protein F511_09764 [Dorcoceras hygrometricum] Length = 79 Score = 52.4 bits (124), Expect = 1e-06 Identities = 24/46 (52%), Positives = 30/46 (65%) Frame = +2 Query: 107 GPFTGTYQSPGYTLDFPSPGLPTGTLPSPSVGSGSPTLCGFPGVMC 244 G F G++ SPG+ FP+PG G+ PSP G GSPT C FPG+ C Sbjct: 13 GGFPGSFPSPGFGGVFPNPGFG-GSFPSPIPGFGSPTFCPFPGLWC 57