BLASTX nr result
ID: Angelica27_contig00025208
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025208 (276 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249001.1 PREDICTED: reticulon-like protein B6 [Daucus caro... 57 2e-07 >XP_017249001.1 PREDICTED: reticulon-like protein B6 [Daucus carota subsp. sativus] KZM95347.1 hypothetical protein DCAR_018589 [Daucus carota subsp. sativus] Length = 292 Score = 56.6 bits (135), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 2/36 (5%) Frame = -2 Query: 128 HDRHVSFAMSVTGS--IKKNRLFGRQKPIHSVLGGG 27 HDRHVSF SV+ S +KKNRLFGRQKP+H+VLGGG Sbjct: 67 HDRHVSFDTSVSHSRSLKKNRLFGRQKPVHTVLGGG 102