BLASTX nr result
ID: Angelica27_contig00025122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025122 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM91476.1 hypothetical protein DCAR_021159 [Daucus carota subsp... 59 4e-08 XP_017256655.1 PREDICTED: cellulose synthase-like protein H1 [Da... 59 6e-08 XP_017250018.1 PREDICTED: cellulose synthase-like protein H1 [Da... 59 6e-08 KZN03271.1 hypothetical protein DCAR_012027 [Daucus carota subsp... 57 5e-07 EEF33041.1 conserved hypothetical protein [Ricinus communis] 56 9e-07 XP_015580960.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthas... 56 9e-07 >KZM91476.1 hypothetical protein DCAR_021159 [Daucus carota subsp. sativus] Length = 306 Score = 59.3 bits (142), Expect = 4e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKWSIKA 229 GL+GKGK+GIPS TILKS VLALMFTHFCK S KA Sbjct: 272 GLYGKGKYGIPSLTILKSGVLALMFTHFCKLSEKA 306 >XP_017256655.1 PREDICTED: cellulose synthase-like protein H1 [Daucus carota subsp. sativus] Length = 737 Score = 59.3 bits (142), Expect = 6e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKWSIKA 229 GL+GKGK+GIPS TILKS VLALMFTHFCK S KA Sbjct: 703 GLYGKGKYGIPSLTILKSGVLALMFTHFCKLSEKA 737 >XP_017250018.1 PREDICTED: cellulose synthase-like protein H1 [Daucus carota subsp. sativus] Length = 738 Score = 59.3 bits (142), Expect = 6e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKWSIK 232 GLFGKGK+G+PS TI KS V+AL F HFCKWS+K Sbjct: 704 GLFGKGKYGLPSTTIFKSGVMALCFMHFCKWSVK 737 >KZN03271.1 hypothetical protein DCAR_012027 [Daucus carota subsp. sativus] Length = 533 Score = 56.6 bits (135), Expect = 5e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKWSIKA 229 GLFGKGK+GIPS TI+KS VLAL+FT FC WS A Sbjct: 499 GLFGKGKYGIPSSTIVKSGVLALLFTQFCIWSTNA 533 >EEF33041.1 conserved hypothetical protein [Ricinus communis] Length = 576 Score = 55.8 bits (133), Expect = 9e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKW 241 GLFGKGK+GIP PTI S++LAL F HFCKW Sbjct: 542 GLFGKGKYGIPLPTICMSIMLALSFVHFCKW 572 >XP_015580960.1 PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein B4, partial [Ricinus communis] Length = 650 Score = 55.8 bits (133), Expect = 9e-07 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = -1 Query: 333 GLFGKGKHGIPSPTILKSVVLALMFTHFCKW 241 GLFGKGK+GIP PTI S++LAL F HFCKW Sbjct: 616 GLFGKGKYGIPLPTICMSIMLALSFVHFCKW 646