BLASTX nr result
ID: Angelica27_contig00025118
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00025118 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAT45380.1 Polyadenylate-binding protein 2, partial [Anthurium a... 60 4e-09 >JAT45380.1 Polyadenylate-binding protein 2, partial [Anthurium amnicola] Length = 107 Score = 60.1 bits (144), Expect = 4e-09 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = +3 Query: 141 MGRLCCESDDDSVLLGLVAMIVIVMVLFITCIPPQPPRRVAIYHC 275 MG+LCC DDDS LLG V +++VMVL + P P RRV +YHC Sbjct: 62 MGKLCCSDDDDSNLLGFVVALLVVMVLLLLLCQPTPRRRVTVYHC 106