BLASTX nr result
ID: Angelica27_contig00024485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024485 (413 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247547.1 PREDICTED: calcium-transporting ATPase 1, chlorop... 57 6e-07 >XP_017247547.1 PREDICTED: calcium-transporting ATPase 1, chloroplastic-like [Daucus carota subsp. sativus] KZM99823.1 hypothetical protein DCAR_012815 [Daucus carota subsp. sativus] Length = 1015 Score = 57.4 bits (137), Expect = 6e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -1 Query: 92 KEKLRVAVLVSQAALQFIHGITYKIPEDVK 3 +EKLRVAVLVSQAALQFIHGI YKIPEDVK Sbjct: 59 QEKLRVAVLVSQAALQFIHGIAYKIPEDVK 88