BLASTX nr result
ID: Angelica27_contig00024240
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024240 (1137 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233909.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 7e-32 CAN73046.1 hypothetical protein VITISV_008668 [Vitis vinifera] 117 1e-25 XP_019080009.1 PREDICTED: pentatricopeptide repeat-containing pr... 117 2e-25 XP_015874838.1 PREDICTED: pentatricopeptide repeat-containing pr... 116 4e-25 XP_017408887.1 PREDICTED: pentatricopeptide repeat-containing pr... 116 4e-25 XP_007135119.1 hypothetical protein PHAVU_010G102600g [Phaseolus... 116 4e-25 XP_002265372.1 PREDICTED: pentatricopeptide repeat-containing pr... 115 7e-25 XP_015967126.1 PREDICTED: pentatricopeptide repeat-containing pr... 110 1e-24 XP_006364306.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 1e-24 XP_015063854.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-24 XP_004233837.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 2e-24 KHN08489.1 Pentatricopeptide repeat-containing protein [Glycine ... 113 3e-24 XP_014515199.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-24 XP_006594568.1 PREDICTED: pentatricopeptide repeat-containing pr... 113 4e-24 XP_019262971.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-23 XP_019168703.1 PREDICTED: pentatricopeptide repeat-containing pr... 112 1e-23 XP_011001225.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-23 XP_006377412.1 pentatricopeptide repeat-containing family protei... 111 2e-23 XP_009775861.1 PREDICTED: pentatricopeptide repeat-containing pr... 111 2e-23 GAU38126.1 hypothetical protein TSUD_318130 [Trifolium subterran... 108 3e-23 >XP_017233909.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Daucus carota subsp. sativus] KZN07160.1 hypothetical protein DCAR_007997 [Daucus carota subsp. sativus] Length = 477 Score = 135 bits (339), Expect = 7e-32 Identities = 65/81 (80%), Positives = 73/81 (90%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGISVE+ETFD L++ FC+KGD+HKAARI+EEMVLDGCIP+ETTWST+LRGF DRK Sbjct: 397 SMRTRGISVEAETFDLLLNCFCKKGDLHKAARIVEEMVLDGCIPSETTWSTILRGFSDRK 456 Query: 934 KVREAAELVQVELVDKFMESH 872 KV E AEL VELVDKF ESH Sbjct: 457 KVWETAELELVELVDKFTESH 477 >CAN73046.1 hypothetical protein VITISV_008668 [Vitis vinifera] Length = 477 Score = 117 bits (294), Expect = 1e-25 Identities = 52/78 (66%), Positives = 68/78 (87%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGIS++++TFD LV+ FC KGD+HKAA +++EMVLDGCIP+E TW+ V+ FWDR+ Sbjct: 397 SMRTRGISIDAKTFDSLVNYFCNKGDLHKAAHLVDEMVLDGCIPDEXTWNAVVCAFWDRR 456 Query: 934 KVREAAELVQVELVDKFM 881 KVRE+AELVQVEL+ F+ Sbjct: 457 KVRESAELVQVELMGTFL 474 >XP_019080009.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X2 [Vitis vinifera] Length = 492 Score = 117 bits (292), Expect = 2e-25 Identities = 51/79 (64%), Positives = 69/79 (87%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGIS++++TFD LV+ FC KGD+HKAA +++EMVLDGCIP+E TW+ V+ FWDR+ Sbjct: 397 SMRTRGISIDAKTFDSLVNYFCNKGDLHKAAHLVDEMVLDGCIPDEVTWNAVVCAFWDRR 456 Query: 934 KVREAAELVQVELVDKFME 878 KVRE+AELVQVEL+ + ++ Sbjct: 457 KVRESAELVQVELMGRALD 475 >XP_015874838.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ziziphus jujuba] XP_015874847.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ziziphus jujuba] XP_015874859.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ziziphus jujuba] XP_015874866.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ziziphus jujuba] Length = 477 Score = 116 bits (290), Expect = 4e-25 Identities = 51/80 (63%), Positives = 70/80 (87%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGI++++ TFD LV FC+KGD+HKAARI++EM+ DGC+P+E TWS+V+ GFWDR+ Sbjct: 398 SMRTRGITIDAFTFDSLVKCFCKKGDLHKAARIVDEMLHDGCVPDEETWSSVVSGFWDRR 457 Query: 934 KVREAAELVQVELVDKFMES 875 KVREAAEL+Q L++ F+E+ Sbjct: 458 KVREAAELLQAGLMNDFVEA 477 >XP_017408887.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408888.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408889.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408890.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408891.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408892.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] XP_017408893.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna angularis] KOM28419.1 hypothetical protein LR48_Vigan543s000700 [Vigna angularis] BAT97985.1 hypothetical protein VIGAN_09158400 [Vigna angularis var. angularis] Length = 479 Score = 116 bits (290), Expect = 4e-25 Identities = 55/80 (68%), Positives = 66/80 (82%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGISVE TFD LV FC++GD+HKAARI++EMVLDGCIP+E W+ V+ G WDRK Sbjct: 398 SMRTRGISVEVGTFDCLVKCFCKRGDLHKAARILDEMVLDGCIPDEQIWNVVIGGLWDRK 457 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA EL+ VEL KF+E+ Sbjct: 458 KVREATELLLVELRQKFVEA 477 >XP_007135119.1 hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] XP_007135120.1 hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] ESW07113.1 hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] ESW07114.1 hypothetical protein PHAVU_010G102600g [Phaseolus vulgaris] Length = 479 Score = 116 bits (290), Expect = 4e-25 Identities = 55/80 (68%), Positives = 66/80 (82%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGISVE TFD LV FC++GD+HKAARI++EMVLDGCIP+E W+ V+ G WDRK Sbjct: 398 SMRTRGISVEVGTFDCLVKCFCKRGDLHKAARILDEMVLDGCIPDEQIWNVVIGGLWDRK 457 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA EL+ VEL KF+E+ Sbjct: 458 KVREATELLLVELRQKFVEA 477 >XP_002265372.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658779.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658782.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658783.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658784.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658786.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_010658787.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_019080005.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_019080006.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_019080007.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] XP_019080008.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 isoform X1 [Vitis vinifera] CBI35257.3 unnamed protein product, partial [Vitis vinifera] Length = 503 Score = 115 bits (289), Expect = 7e-25 Identities = 51/74 (68%), Positives = 66/74 (89%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGIS++++TFD LV+ FC KGD+HKAA +++EMVLDGCIP+E TW+ V+ FWDR+ Sbjct: 397 SMRTRGISIDAKTFDSLVNYFCNKGDLHKAAHLVDEMVLDGCIPDEVTWNAVVCAFWDRR 456 Query: 934 KVREAAELVQVELV 893 KVRE+AELVQVEL+ Sbjct: 457 KVRESAELVQVELM 470 >XP_015967126.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Arachis duranensis] XP_015967127.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Arachis duranensis] XP_015967128.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Arachis duranensis] Length = 234 Score = 110 bits (274), Expect = 1e-24 Identities = 50/80 (62%), Positives = 64/80 (80%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 S RTRG+S+E TFD LV FC++GD+HKAARI++EMVLDGCIP+E W+ V+ G WDRK Sbjct: 153 STRTRGVSIEVGTFDCLVKCFCKRGDLHKAARILDEMVLDGCIPDEGIWNAVIVGLWDRK 212 Query: 934 KVREAAELVQVELVDKFMES 875 +VREA EL+ EL KF+E+ Sbjct: 213 RVREATELLLAELKQKFVEA 232 >XP_006364306.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Solanum tuberosum] XP_006364307.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Solanum tuberosum] Length = 479 Score = 114 bits (286), Expect = 1e-24 Identities = 52/78 (66%), Positives = 66/78 (84%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE+++F+ LV+ FC+KGDVHK ARI+EEM+ DGCIP+E TW+ VL GFWDR+ Sbjct: 398 SMRTRAISVEAKSFETLVNHFCKKGDVHKVARIVEEMLTDGCIPDEQTWAVVLGGFWDRR 457 Query: 934 KVREAAELVQVELVDKFM 881 KVREAA+ VQ +L+ K M Sbjct: 458 KVREAADSVQADLMCKHM 475 >XP_015063854.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Solanum pennellii] Length = 479 Score = 114 bits (285), Expect = 2e-24 Identities = 51/78 (65%), Positives = 66/78 (84%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE+++F+ LV+ FC+KGDVHK ARI+EEM+ DGCIP+E TW+ V+ GFWDR+ Sbjct: 398 SMRTRAISVEAKSFETLVNHFCKKGDVHKVARIVEEMLTDGCIPDEKTWAVVVGGFWDRR 457 Query: 934 KVREAAELVQVELVDKFM 881 KVREAA+ VQ +L+ K M Sbjct: 458 KVREAADSVQADLMPKHM 475 >XP_004233837.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Solanum lycopersicum] XP_010316778.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Solanum lycopersicum] Length = 479 Score = 114 bits (285), Expect = 2e-24 Identities = 51/78 (65%), Positives = 66/78 (84%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE+++F+ LV+ FC+KGDVHK ARI+EEM+ DGCIP+E TW+ V+ GFWDR+ Sbjct: 398 SMRTRAISVEAKSFETLVNHFCKKGDVHKVARIVEEMLTDGCIPDEKTWAVVVGGFWDRR 457 Query: 934 KVREAAELVQVELVDKFM 881 KVREAA+ VQ +L+ K M Sbjct: 458 KVREAADSVQADLMPKHM 475 >KHN08489.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 446 Score = 113 bits (283), Expect = 3e-24 Identities = 54/80 (67%), Positives = 65/80 (81%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE +TFD LV FC++GD+HKAARI+EEMVLDGCIP+E W+ V+ G WDRK Sbjct: 365 SMRTRCISVEIDTFDCLVKCFCKRGDLHKAARILEEMVLDGCIPDEGVWNVVIGGLWDRK 424 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA E + VEL KF+E+ Sbjct: 425 KVREATEQLLVELQQKFVEA 444 >XP_014515199.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna radiata var. radiata] XP_014515200.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna radiata var. radiata] XP_014515201.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Vigna radiata var. radiata] Length = 479 Score = 113 bits (283), Expect = 4e-24 Identities = 53/80 (66%), Positives = 65/80 (81%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 S+RTRGISVE TFD LV FC++GD+HKAARI++EMVLDGCIP+E W+ V+ G WDRK Sbjct: 398 SLRTRGISVEVGTFDCLVKCFCKRGDLHKAARILDEMVLDGCIPDEQIWNVVIGGLWDRK 457 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA EL+ EL KF+E+ Sbjct: 458 KVREATELLLAELRQKFVEA 477 >XP_006594568.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Glycine max] KRH21357.1 hypothetical protein GLYMA_13G235200 [Glycine max] KRH21358.1 hypothetical protein GLYMA_13G235200 [Glycine max] Length = 479 Score = 113 bits (283), Expect = 4e-24 Identities = 54/80 (67%), Positives = 65/80 (81%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE +TFD LV FC++GD+HKAARI+EEMVLDGCIP+E W+ V+ G WDRK Sbjct: 398 SMRTRCISVEIDTFDCLVKCFCKRGDLHKAARILEEMVLDGCIPDEGVWNVVIGGLWDRK 457 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA E + VEL KF+E+ Sbjct: 458 KVREATEQLLVELQQKFVEA 477 >XP_019262971.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Nicotiana attenuata] XP_019262972.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Nicotiana attenuata] OIT37443.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 479 Score = 112 bits (279), Expect = 1e-23 Identities = 51/79 (64%), Positives = 66/79 (83%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE ++F+ LV+ FC+KGDVHKAARI+EEM++DG IP+E TW+ V+ GFWDR+ Sbjct: 398 SMRTRAISVEDKSFEILVNHFCKKGDVHKAARIVEEMLIDGSIPDEQTWAVVVGGFWDRR 457 Query: 934 KVREAAELVQVELVDKFME 878 KVREAA+ VQ L+ K M+ Sbjct: 458 KVREAADSVQAALMYKCMD 476 >XP_019168703.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ipomoea nil] XP_019168705.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ipomoea nil] XP_019168706.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Ipomoea nil] Length = 485 Score = 112 bits (279), Expect = 1e-23 Identities = 52/79 (65%), Positives = 62/79 (78%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 S+RTRGISVE+ETF LV FC+KGD+HK+ARIIEEMV+DGCIP TW+ VL FWDR+ Sbjct: 398 SIRTRGISVEAETFKLLVGHFCKKGDLHKSARIIEEMVIDGCIPGTGTWTAVLDAFWDRR 457 Query: 934 KVREAAELVQVELVDKFME 878 K +EA EL EL+ K ME Sbjct: 458 KAKEATELAFSELMTKLME 476 >XP_011001225.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Populus euphratica] Length = 478 Score = 111 bits (278), Expect = 2e-23 Identities = 50/78 (64%), Positives = 65/78 (83%) Frame = -3 Query: 1111 MRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRKK 932 MRTRGIS+++ TFD LV FC+KGD+HKAARI +EMVLDGC+P+ WS V+ GFWDR+K Sbjct: 399 MRTRGISIDAVTFDSLVKCFCKKGDLHKAARIFDEMVLDGCVPDHGIWSAVVGGFWDRRK 458 Query: 931 VREAAELVQVELVDKFME 878 VREA E + VEL+++F+E Sbjct: 459 VREAFESIVVELMNEFVE 476 >XP_006377412.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] ERP55209.1 pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 478 Score = 111 bits (278), Expect = 2e-23 Identities = 50/78 (64%), Positives = 65/78 (83%) Frame = -3 Query: 1111 MRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRKK 932 MRTRGIS+++ TFD LV FC+KGD+HKAARI +EMVLDGC+P+ WS V+ GFWDR+K Sbjct: 399 MRTRGISIDAGTFDSLVKCFCKKGDLHKAARIFDEMVLDGCVPDHGIWSAVVGGFWDRRK 458 Query: 931 VREAAELVQVELVDKFME 878 VREA E + VEL+++F+E Sbjct: 459 VREAFESIVVELMNEFVE 476 >XP_009775861.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Nicotiana sylvestris] XP_009775862.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100 [Nicotiana sylvestris] XP_016434069.1 PREDICTED: pentatricopeptide repeat-containing protein At5g46100-like [Nicotiana tabacum] Length = 479 Score = 111 bits (278), Expect = 2e-23 Identities = 51/79 (64%), Positives = 66/79 (83%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTR ISVE ++F+ LV+ FC+KGDVHKAARI+EEM++DG IP+E TW+ V+ GFWDR+ Sbjct: 398 SMRTRAISVEDKSFEILVNHFCKKGDVHKAARIVEEMLIDGSIPDEQTWAVVVGGFWDRR 457 Query: 934 KVREAAELVQVELVDKFME 878 KVREAA+ VQ L+ K M+ Sbjct: 458 KVREAADSVQAALMYKRMD 476 >GAU38126.1 hypothetical protein TSUD_318130 [Trifolium subterraneum] Length = 296 Score = 108 bits (269), Expect = 3e-23 Identities = 49/80 (61%), Positives = 64/80 (80%) Frame = -3 Query: 1114 SMRTRGISVESETFDFLVDRFCRKGDVHKAARIIEEMVLDGCIPNETTWSTVLRGFWDRK 935 SMRTRGISVE +TFD LV FC++GD++KA+RI++EM+LDGCIP+E W+ ++ G WDRK Sbjct: 216 SMRTRGISVEIDTFDCLVKCFCKRGDLNKASRILDEMILDGCIPDEGIWNVLMCGLWDRK 275 Query: 934 KVREAAELVQVELVDKFMES 875 KVREA EL+ EL F E+ Sbjct: 276 KVREATELLLAELKQNFFEA 295