BLASTX nr result
ID: Angelica27_contig00024119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024119 (420 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017227205.1 PREDICTED: probable receptor-like protein kinase ... 89 5e-18 KZM81673.1 hypothetical protein DCAR_029286 [Daucus carota subsp... 83 9e-16 CDP15187.1 unnamed protein product [Coffea canephora] 80 5e-15 XP_016538842.1 PREDICTED: probable receptor-like protein kinase ... 76 2e-13 XP_015060358.1 PREDICTED: probable receptor-like protein kinase ... 76 2e-13 XP_006358542.1 PREDICTED: probable receptor-like protein kinase ... 76 2e-13 XP_010313851.1 PREDICTED: probable receptor-like protein kinase ... 76 2e-13 XP_019233300.1 PREDICTED: probable receptor-like protein kinase ... 75 5e-13 XP_016435172.1 PREDICTED: probable receptor-like protein kinase ... 75 5e-13 XP_009793441.1 PREDICTED: probable receptor-like protein kinase ... 75 5e-13 XP_009593728.1 PREDICTED: probable receptor-like protein kinase ... 75 5e-13 XP_016492559.1 PREDICTED: probable receptor-like protein kinase ... 75 5e-13 XP_018844288.1 PREDICTED: probable receptor-like protein kinase ... 74 7e-13 XP_010276545.1 PREDICTED: probable receptor-like protein kinase ... 74 1e-12 XP_018816477.1 PREDICTED: probable receptor-like protein kinase ... 72 7e-12 XP_015900160.1 PREDICTED: probable receptor-like protein kinase ... 71 9e-12 XP_011023858.1 PREDICTED: probable receptor-like protein kinase ... 71 1e-11 XP_010270970.1 PREDICTED: probable receptor-like protein kinase ... 70 2e-11 EEF50023.1 Interleukin-1 receptor-associated kinase, putative [R... 69 4e-11 XP_015570623.1 PREDICTED: LOW QUALITY PROTEIN: probable receptor... 69 4e-11 >XP_017227205.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Daucus carota subsp. sativus] Length = 504 Score = 89.0 bits (219), Expect = 5e-18 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESYDTDRSDNPDPRSASNRVI 273 VRMLESEEYPIPREERRHRRS+AGSA+ ESYDTDRSDNP+ RS S RVI Sbjct: 456 VRMLESEEYPIPREERRHRRSQAGSADFESYDTDRSDNPESRSGSKRVI 504 >KZM81673.1 hypothetical protein DCAR_029286 [Daucus carota subsp. sativus] Length = 790 Score = 82.8 bits (203), Expect = 9e-16 Identities = 39/48 (81%), Positives = 42/48 (87%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESYDTDRSDNPDPRSASNRV 276 VRMLESEEYPIPREERRHRRS+AGSA+ ESYDTDRSDNP+ RS V Sbjct: 399 VRMLESEEYPIPREERRHRRSQAGSADFESYDTDRSDNPESRSVIEMV 446 >CDP15187.1 unnamed protein product [Coffea canephora] Length = 509 Score = 80.5 bits (197), Expect = 5e-15 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 4/51 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES----YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RRHRR++AGS EIES YDTD+SDNP+PRS S R Sbjct: 455 VRMLESEEYPIPREDRRHRRTQAGSTEIESQRENYDTDKSDNPEPRSESKR 505 >XP_016538842.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Capsicum annuum] XP_016538843.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Capsicum annuum] Length = 507 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RRS+AG+ E +S YDTD+SDNPDPRS S R Sbjct: 455 VRMLESEEYPIPREDRRQRRSQAGNGESDSQNYDTDKSDNPDPRSESRR 503 >XP_015060358.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum pennellii] XP_015060361.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum pennellii] XP_015060362.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum pennellii] Length = 508 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RRS+AG+ E +S YDTD+SDNPDPRS S R Sbjct: 456 VRMLESEEYPIPREDRRQRRSQAGNGESDSQNYDTDKSDNPDPRSESRR 504 >XP_006358542.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum tuberosum] XP_006358543.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum tuberosum] XP_006358544.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum tuberosum] Length = 508 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RRS+AG+ E +S YDTD+SDNPDPRS S R Sbjct: 456 VRMLESEEYPIPREDRRQRRSQAGNGESDSQNYDTDKSDNPDPRSESRR 504 >XP_010313851.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum lycopersicum] XP_010313854.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Solanum lycopersicum] Length = 508 Score = 76.3 bits (186), Expect = 2e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RRS+AG+ E +S YDTD+SDNPDPRS S R Sbjct: 456 VRMLESEEYPIPREDRRQRRSQAGNGESDSQNYDTDKSDNPDPRSESRR 504 >XP_019233300.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana attenuata] OIT27463.1 putative receptor-like protein kinase [Nicotiana attenuata] Length = 507 Score = 74.7 bits (182), Expect = 5e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RR++AG+AE ES YDTD+SDNPD RS S R Sbjct: 455 VRMLESEEYPIPREDRRQRRAQAGNAESESQNYDTDKSDNPDSRSESRR 503 >XP_016435172.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana tabacum] Length = 507 Score = 74.7 bits (182), Expect = 5e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RR++AG+AE ES YDTD+SDNPD RS S R Sbjct: 455 VRMLESEEYPIPREDRRQRRAQAGNAESESQNYDTDKSDNPDSRSESRR 503 >XP_009793441.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana sylvestris] Length = 507 Score = 74.7 bits (182), Expect = 5e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RR++AG+AE ES YDTD+SDNPD RS S R Sbjct: 455 VRMLESEEYPIPREDRRQRRAQAGNAESESQNYDTDKSDNPDSRSESRR 503 >XP_009593728.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana tomentosiformis] Length = 507 Score = 74.7 bits (182), Expect = 5e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RR++AG+AE ES YDTD+SDNPD RS S R Sbjct: 455 VRMLESEEYPIPREDRRQRRAQAGNAESESQNYDTDKSDNPDSRSESRR 503 >XP_016492559.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nicotiana tabacum] Length = 516 Score = 74.7 bits (182), Expect = 5e-13 Identities = 37/49 (75%), Positives = 42/49 (85%), Gaps = 2/49 (4%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIES--YDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RR RR++AG+AE ES YDTD+SDNPD RS S R Sbjct: 464 VRMLESEEYPIPREDRRQRRAQAGNAESESQNYDTDKSDNPDSRSESRR 512 >XP_018844288.1 PREDICTED: probable receptor-like protein kinase At2g42960 [Juglans regia] XP_018844289.1 PREDICTED: probable receptor-like protein kinase At2g42960 [Juglans regia] Length = 511 Score = 74.3 bits (181), Expect = 7e-13 Identities = 38/49 (77%), Positives = 41/49 (83%), Gaps = 4/49 (8%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSAS 285 VRMLESEEYPIPRE+RRHRR++AGS EIES DTDRSDNPD RS S Sbjct: 457 VRMLESEEYPIPREDRRHRRTQAGSMEIESQKDFSDTDRSDNPDSRSNS 505 >XP_010276545.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nelumbo nucifera] Length = 510 Score = 73.9 bits (180), Expect = 1e-12 Identities = 37/51 (72%), Positives = 42/51 (82%), Gaps = 4/51 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RRHRRS+AGS EIES DTD+SDNPD R+ S + Sbjct: 457 VRMLESEEYPIPREDRRHRRSQAGSIEIESQRENSDTDKSDNPDSRADSRK 507 >XP_018816477.1 PREDICTED: probable receptor-like protein kinase At2g42960 [Juglans regia] Length = 510 Score = 71.6 bits (174), Expect = 7e-12 Identities = 36/49 (73%), Positives = 41/49 (83%), Gaps = 4/49 (8%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSAS 285 VRMLESEEYPIPRE+RRHRR++AGS EIES DT++SDNPD RS S Sbjct: 456 VRMLESEEYPIPREDRRHRRTQAGSMEIESQKEFSDTEKSDNPDSRSNS 504 >XP_015900160.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Ziziphus jujuba] XP_015900161.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Ziziphus jujuba] Length = 508 Score = 71.2 bits (173), Expect = 9e-12 Identities = 35/51 (68%), Positives = 42/51 (82%), Gaps = 4/51 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEI----ESYDTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RRHRRS+AG++E E+ DTDRSDNP+ RS + R Sbjct: 454 VRMLESEEYPIPREDRRHRRSQAGNSEAERQRENSDTDRSDNPEGRSGNRR 504 >XP_011023858.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Populus euphratica] Length = 507 Score = 70.9 bits (172), Expect = 1e-11 Identities = 36/52 (69%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSASNRV 276 VRMLESEEYPIPRE+RRHRR+ GS EIES DTDRSD+P RS S R+ Sbjct: 456 VRMLESEEYPIPREDRRHRRTRGGSMEIESQRENSDTDRSDHPGSRSESRRI 507 >XP_010270970.1 PREDICTED: probable receptor-like protein kinase At5g18500 [Nelumbo nucifera] Length = 511 Score = 70.5 bits (171), Expect = 2e-11 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 4/50 (8%) Frame = -2 Query: 416 RMLESEEYPIPREERRHRRSEAGSAEI----ESYDTDRSDNPDPRSASNR 279 RMLESEEYPIPRE+RRHRRS+AGS EI E+ DTD+SDNPD R S R Sbjct: 458 RMLESEEYPIPREDRRHRRSQAGSMEIECQRENSDTDKSDNPDLRVESRR 507 >EEF50023.1 Interleukin-1 receptor-associated kinase, putative [Ricinus communis] Length = 461 Score = 69.3 bits (168), Expect = 4e-11 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 4/51 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RRHRR++ GS +IES DTDRSD+P RS S R Sbjct: 410 VRMLESEEYPIPREDRRHRRTQGGSMDIESQKENSDTDRSDHPGSRSESRR 460 >XP_015570623.1 PREDICTED: LOW QUALITY PROTEIN: probable receptor-like protein kinase At5g18500 [Ricinus communis] Length = 498 Score = 69.3 bits (168), Expect = 4e-11 Identities = 35/51 (68%), Positives = 40/51 (78%), Gaps = 4/51 (7%) Frame = -2 Query: 419 VRMLESEEYPIPREERRHRRSEAGSAEIESY----DTDRSDNPDPRSASNR 279 VRMLESEEYPIPRE+RRHRR++ GS +IES DTDRSD+P RS S R Sbjct: 447 VRMLESEEYPIPREDRRHRRTQGGSMDIESQKENSDTDRSDHPGSRSESRR 497