BLASTX nr result
ID: Angelica27_contig00024073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00024073 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017221719.1 PREDICTED: translocase of chloroplast 159, chloro... 60 3e-08 >XP_017221719.1 PREDICTED: translocase of chloroplast 159, chloroplastic-like [Daucus carota subsp. sativus] KZM85504.1 hypothetical protein DCAR_027074 [Daucus carota subsp. sativus] Length = 1193 Score = 59.7 bits (143), Expect = 3e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 123 GFSGAARIPVLETLENLSTLKGQVLGVGDGAIDENELQFK 242 GFSG ARI VLETLE LS K QVLGVGDG ++E++LQFK Sbjct: 411 GFSGVARISVLETLEKLSVAKDQVLGVGDGDVEEDKLQFK 450