BLASTX nr result
ID: Angelica27_contig00023969
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023969 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225533.1 PREDICTED: thioredoxin-like protein CITRX2, chlor... 61 6e-10 KZM82132.1 hypothetical protein DCAR_031839 [Daucus carota subsp... 61 8e-10 >XP_017225533.1 PREDICTED: thioredoxin-like protein CITRX2, chloroplastic [Daucus carota subsp. sativus] Length = 166 Score = 60.8 bits (146), Expect = 6e-10 Identities = 30/51 (58%), Positives = 32/51 (62%) Frame = +1 Query: 46 MQMAAPFFSPPPLCNSQFGLKTKRPNWXXXXXXXXXXXXXXXRRLVCQPPS 198 MQMAAPFFSPPPLCNSQ +T RPNW RRLVC+PPS Sbjct: 1 MQMAAPFFSPPPLCNSQLRSETNRPNW-LISPTPFKTSTLSTRRLVCKPPS 50 >KZM82132.1 hypothetical protein DCAR_031839 [Daucus carota subsp. sativus] Length = 188 Score = 60.8 bits (146), Expect = 8e-10 Identities = 30/51 (58%), Positives = 32/51 (62%) Frame = +1 Query: 46 MQMAAPFFSPPPLCNSQFGLKTKRPNWXXXXXXXXXXXXXXXRRLVCQPPS 198 MQMAAPFFSPPPLCNSQ +T RPNW RRLVC+PPS Sbjct: 1 MQMAAPFFSPPPLCNSQLRSETNRPNW-LISPTPFKTSTLSTRRLVCKPPS 50