BLASTX nr result
ID: Angelica27_contig00023865
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023865 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242624.1 PREDICTED: CCR4-NOT transcription complex subunit... 66 1e-10 KZN00569.1 hypothetical protein DCAR_009323 [Daucus carota subsp... 66 1e-10 XP_017214941.1 PREDICTED: CCR4-NOT transcription complex subunit... 57 3e-07 KZM91746.1 hypothetical protein DCAR_020889 [Daucus carota subsp... 57 3e-07 XP_019255944.1 PREDICTED: CCR4-NOT transcription complex subunit... 52 1e-05 XP_016510421.1 PREDICTED: CCR4-NOT transcription complex subunit... 52 1e-05 XP_016448045.1 PREDICTED: CCR4-NOT transcription complex subunit... 52 1e-05 XP_009779024.1 PREDICTED: CCR4-NOT transcription complex subunit... 52 1e-05 XP_009613357.1 PREDICTED: CCR4-NOT transcription complex subunit... 52 1e-05 >XP_017242624.1 PREDICTED: CCR4-NOT transcription complex subunit 10-like [Daucus carota subsp. sativus] Length = 840 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 172 DASLSLAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 DASLSLAK+AS+LFHSA DCL VL QLL TKP+DPKVLH Sbjct: 17 DASLSLAKQASLLFHSANFADCLTVLRQLLLTKPSDPKVLH 57 >KZN00569.1 hypothetical protein DCAR_009323 [Daucus carota subsp. sativus] Length = 877 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = +1 Query: 172 DASLSLAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 DASLSLAK+AS+LFHSA DCL VL QLL TKP+DPKVLH Sbjct: 17 DASLSLAKQASLLFHSANFADCLTVLRQLLLTKPSDPKVLH 57 >XP_017214941.1 PREDICTED: CCR4-NOT transcription complex subunit 10-like [Daucus carota subsp. sativus] Length = 845 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 184 SLAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 +LAKEA+VLFHS DCL++L QLLH KP DPKVLH Sbjct: 26 ALAKEAAVLFHSGNFSDCLQLLLQLLHYKPTDPKVLH 62 >KZM91746.1 hypothetical protein DCAR_020889 [Daucus carota subsp. sativus] Length = 851 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = +1 Query: 184 SLAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 +LAKEA+VLFHS DCL++L QLLH KP DPKVLH Sbjct: 26 ALAKEAAVLFHSGNFSDCLQLLLQLLHYKPTDPKVLH 62 >XP_019255944.1 PREDICTED: CCR4-NOT transcription complex subunit 10-B [Nicotiana attenuata] OIS97096.1 hypothetical protein A4A49_04207 [Nicotiana attenuata] Length = 864 Score = 52.4 bits (124), Expect = 1e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 187 LAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 LAKEA++LF S K DC +VLHQLL K DPKVLH Sbjct: 34 LAKEAALLFQSGKFADCCRVLHQLLQKKERDPKVLH 69 >XP_016510421.1 PREDICTED: CCR4-NOT transcription complex subunit 10-like [Nicotiana tabacum] Length = 864 Score = 52.4 bits (124), Expect = 1e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 187 LAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 LAKEA++LF S K DC +VLHQLL K DPKVLH Sbjct: 34 LAKEAALLFQSGKFADCCRVLHQLLQKKERDPKVLH 69 >XP_016448045.1 PREDICTED: CCR4-NOT transcription complex subunit 10-like [Nicotiana tabacum] Length = 864 Score = 52.4 bits (124), Expect = 1e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 187 LAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 LAKEA++LF S K DC +VLHQLL K DPKVLH Sbjct: 34 LAKEAALLFQSGKFADCCRVLHQLLQKKERDPKVLH 69 >XP_009779024.1 PREDICTED: CCR4-NOT transcription complex subunit 10 [Nicotiana sylvestris] Length = 864 Score = 52.4 bits (124), Expect = 1e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 187 LAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 LAKEA++LF S K DC +VLHQLL K DPKVLH Sbjct: 34 LAKEAALLFQSGKFADCCRVLHQLLQKKERDPKVLH 69 >XP_009613357.1 PREDICTED: CCR4-NOT transcription complex subunit 10 [Nicotiana tomentosiformis] Length = 864 Score = 52.4 bits (124), Expect = 1e-05 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = +1 Query: 187 LAKEASVLFHSAKLVDCLKVLHQLLHTKPADPKVLH 294 LAKEA++LF S K DC +VLHQLL K DPKVLH Sbjct: 34 LAKEAALLFQSGKFADCCRVLHQLLQKKERDPKVLH 69