BLASTX nr result
ID: Angelica27_contig00023847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023847 (272 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236013.1 PREDICTED: protein trichome birefringence-like 2 ... 72 9e-13 >XP_017236013.1 PREDICTED: protein trichome birefringence-like 2 [Daucus carota subsp. sativus] KZN06233.1 hypothetical protein DCAR_007070 [Daucus carota subsp. sativus] Length = 608 Score = 72.0 bits (175), Expect = 9e-13 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +3 Query: 147 MDLKKVVSPDHFASFRRKVVSGFGLGLIVSLIFLSVFVFNIS 272 MDLKKV PDHFAS +RKVVSGFGLGL+VSLIFLSVFVFN S Sbjct: 1 MDLKKVGFPDHFASVKRKVVSGFGLGLVVSLIFLSVFVFNSS 42