BLASTX nr result
ID: Angelica27_contig00023676
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023676 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017244398.1 PREDICTED: uncharacterized protein LOC108216214 [... 70 3e-12 >XP_017244398.1 PREDICTED: uncharacterized protein LOC108216214 [Daucus carota subsp. sativus] KZM98095.1 hypothetical protein DCAR_014543 [Daucus carota subsp. sativus] Length = 273 Score = 70.5 bits (171), Expect = 3e-12 Identities = 31/37 (83%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = -1 Query: 104 GVLHPYHHNFYQDLQPFDAFWDSHNTT---DYDLGAE 3 GVLHPYHHNFYQDL PFDA WDSHNT DYDLGAE Sbjct: 7 GVLHPYHHNFYQDLHPFDASWDSHNTALSLDYDLGAE 43