BLASTX nr result
ID: Angelica27_contig00023656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00023656 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM83521.1 hypothetical protein DCAR_031090 [Daucus carota subsp... 65 3e-10 XP_017224408.1 PREDICTED: uncharacterized protein LOC108200682 i... 65 3e-10 >KZM83521.1 hypothetical protein DCAR_031090 [Daucus carota subsp. sativus] Length = 369 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 294 DSLCNNLGKVEKMIQCNLICFSEPTESLALPQLIGNSTCAVMRKPS 157 DS CNNLGK++KMIQ NLICFS+ T+S+ALPQL+ N + AV R S Sbjct: 318 DSSCNNLGKIDKMIQGNLICFSDQTDSVALPQLVANCSSAVKRNQS 363 >XP_017224408.1 PREDICTED: uncharacterized protein LOC108200682 isoform X1 [Daucus carota subsp. sativus] Length = 399 Score = 65.5 bits (158), Expect = 3e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 294 DSLCNNLGKVEKMIQCNLICFSEPTESLALPQLIGNSTCAVMRKPS 157 DS CNNLGK++KMIQ NLICFS+ T+S+ALPQL+ N + AV R S Sbjct: 348 DSSCNNLGKIDKMIQGNLICFSDQTDSVALPQLVANCSSAVKRNQS 393