BLASTX nr result
ID: Angelica27_contig00022992
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022992 (465 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228356.1 PREDICTED: histone-lysine N-methyltransferase, H3... 92 9e-19 >XP_017228356.1 PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6-like [Daucus carota subsp. sativus] XP_017228361.1 PREDICTED: histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6-like [Daucus carota subsp. sativus] KZN11934.1 hypothetical protein DCAR_004590 [Daucus carota subsp. sativus] Length = 1057 Score = 92.0 bits (227), Expect = 9e-19 Identities = 44/46 (95%), Positives = 44/46 (95%) Frame = +2 Query: 83 MVSLLMNNLSEENAMNLPLENGDSGRVKYKRRSVSAVRDFPPGCGP 220 MVSLL NNLSEENAMNLPLENG SGRVKYKRRSVSAVRDFPPGCGP Sbjct: 1 MVSLLKNNLSEENAMNLPLENGGSGRVKYKRRSVSAVRDFPPGCGP 46