BLASTX nr result
ID: Angelica27_contig00022921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022921 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017236960.1 PREDICTED: pentatricopeptide repeat-containing pr... 114 7e-28 >XP_017236960.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Daucus carota subsp. sativus] XP_017236961.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Daucus carota subsp. sativus] XP_017236962.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Daucus carota subsp. sativus] XP_017236963.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Daucus carota subsp. sativus] XP_017236964.1 PREDICTED: pentatricopeptide repeat-containing protein At2g30780-like [Daucus carota subsp. sativus] KZN04994.1 hypothetical protein DCAR_005831 [Daucus carota subsp. sativus] Length = 521 Score = 114 bits (284), Expect = 7e-28 Identities = 60/74 (81%), Positives = 66/74 (89%) Frame = -3 Query: 224 MIRVWKLSESAKSELIITLRTFITKPKNIVPQTPYLITNNPITTSTHRFSLKDSFYSHPN 45 M RV KLS SA+++LI TLRTFITKPK I+PQTP+LITNNPITTST RFSLKDSFYS P+ Sbjct: 1 MKRVLKLSLSAQTDLI-TLRTFITKPKIILPQTPFLITNNPITTSTTRFSLKDSFYSQPS 59 Query: 44 LNSNPFPNIIGLFS 3 LNS PFPNIIGLFS Sbjct: 60 LNSIPFPNIIGLFS 73