BLASTX nr result
ID: Angelica27_contig00022917
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022917 (724 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] 58 8e-08 XP_017246968.1 PREDICTED: uncharacterized protein LOC108218510 [... 60 1e-06 >KGN43564.1 hypothetical protein Csa_7G045530 [Cucumis sativus] Length = 80 Score = 58.2 bits (139), Expect = 8e-08 Identities = 32/68 (47%), Positives = 44/68 (64%) Frame = +2 Query: 239 IVLRIESI*LPRDSFSLASSTKLNCSRSFKKFWGDIKSVILLRVFSRSRSSHIWRLHRVL 418 + + + S+ + + F+LA++T SR+FK W + VI L V +SRSSHIWRL RVL Sbjct: 15 VCIGLVSLVVKKTPFTLAAATSSKSSRTFKWVWDN--GVISLGVLRKSRSSHIWRLCRVL 72 Query: 419 MSLSLDYG 442 LSLDYG Sbjct: 73 EGLSLDYG 80 >XP_017246968.1 PREDICTED: uncharacterized protein LOC108218510 [Daucus carota subsp. sativus] XP_017246970.1 PREDICTED: uncharacterized protein LOC108218510 [Daucus carota subsp. sativus] Length = 676 Score = 59.7 bits (143), Expect = 1e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +2 Query: 617 MIRFSCFNGHIHPSKPKMIDDLHEEAMHKELEDGV 721 MI F+CF+GHI+ SKPKMI+DL EEAMHK LEDG+ Sbjct: 1 MIGFTCFSGHIYSSKPKMINDLPEEAMHKALEDGI 35