BLASTX nr result
ID: Angelica27_contig00022551
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022551 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017218495.1 PREDICTED: paired amphipathic helix protein Sin3-... 57 4e-07 KZM88285.1 hypothetical protein DCAR_025360 [Daucus carota subsp... 57 4e-07 >XP_017218495.1 PREDICTED: paired amphipathic helix protein Sin3-like 2 [Daucus carota subsp. sativus] Length = 1333 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 150 MKRLRDDYVNSPIKKPFASSPAESYGQSQIA 58 MKR+RDD+V+SPIKKPFASSPAES+GQ QIA Sbjct: 1 MKRVRDDFVDSPIKKPFASSPAESHGQPQIA 31 >KZM88285.1 hypothetical protein DCAR_025360 [Daucus carota subsp. sativus] Length = 1362 Score = 57.0 bits (136), Expect = 4e-07 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 150 MKRLRDDYVNSPIKKPFASSPAESYGQSQIA 58 MKR+RDD+V+SPIKKPFASSPAES+GQ QIA Sbjct: 1 MKRVRDDFVDSPIKKPFASSPAESHGQPQIA 31