BLASTX nr result
ID: Angelica27_contig00022477
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022477 (494 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90602.1 hypothetical protein DCAR_022033 [Daucus carota subsp... 57 6e-07 XP_017256211.1 PREDICTED: B3 domain-containing protein Os01g0234... 57 9e-07 XP_017256210.1 PREDICTED: B3 domain-containing protein Os01g0234... 57 9e-07 XP_017256209.1 PREDICTED: putative B3 domain-containing protein ... 57 1e-06 >KZM90602.1 hypothetical protein DCAR_022033 [Daucus carota subsp. sativus] Length = 228 Score = 57.4 bits (137), Expect = 6e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 493 GIAEYKLSNELNHCGTHLMQDHYHNSIGCM 404 GI EYK S ELNHCGTHL+QDH+ NSIGCM Sbjct: 199 GITEYKRSEELNHCGTHLVQDHHLNSIGCM 228 >XP_017256211.1 PREDICTED: B3 domain-containing protein Os01g0234100 isoform X3 [Daucus carota subsp. sativus] XP_017256212.1 PREDICTED: B3 domain-containing protein Os01g0234100 isoform X3 [Daucus carota subsp. sativus] Length = 297 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 493 GIAEYKLSNELNHCGTHLMQDHYHNSIGCM 404 GI EYK S ELNHCGTHL+QDH+ NSIGCM Sbjct: 268 GITEYKRSEELNHCGTHLVQDHHLNSIGCM 297 >XP_017256210.1 PREDICTED: B3 domain-containing protein Os01g0234100 isoform X2 [Daucus carota subsp. sativus] Length = 298 Score = 57.4 bits (137), Expect = 9e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 493 GIAEYKLSNELNHCGTHLMQDHYHNSIGCM 404 GI EYK S ELNHCGTHL+QDH+ NSIGCM Sbjct: 269 GITEYKRSEELNHCGTHLVQDHHLNSIGCM 298 >XP_017256209.1 PREDICTED: putative B3 domain-containing protein At5g58280 isoform X1 [Daucus carota subsp. sativus] Length = 314 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 493 GIAEYKLSNELNHCGTHLMQDHYHNSIGCM 404 GI EYK S ELNHCGTHL+QDH+ NSIGCM Sbjct: 285 GITEYKRSEELNHCGTHLVQDHHLNSIGCM 314