BLASTX nr result
ID: Angelica27_contig00022467
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022467 (365 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017233942.1 PREDICTED: GATA transcription factor 15-like [Dau... 75 3e-22 XP_016477352.1 PREDICTED: GATA transcription factor 17-like [Nic... 60 2e-09 XP_006359887.1 PREDICTED: GATA transcription factor 23-like [Sol... 60 2e-09 XP_016478905.1 PREDICTED: GATA transcription factor 16-like [Nic... 58 2e-08 XP_012837472.1 PREDICTED: GATA transcription factor 15-like [Ery... 58 3e-08 EPS59020.1 hypothetical protein M569_15793, partial [Genlisea au... 57 3e-08 XP_004247383.1 PREDICTED: GATA transcription factor 23-like [Sol... 57 3e-08 XP_016567982.1 PREDICTED: GATA transcription factor 16-like [Cap... 57 3e-08 XP_019263042.1 PREDICTED: GATA transcription factor 16-like [Nic... 57 6e-08 XP_009599707.1 PREDICTED: GATA transcription factor 16-like [Nic... 57 6e-08 XP_009758127.1 PREDICTED: GATA transcription factor 16-like [Nic... 57 7e-08 XP_011082433.1 PREDICTED: GATA transcription factor 15-like [Ses... 57 9e-08 XP_011079598.1 PREDICTED: GATA transcription factor 15-like [Ses... 57 9e-08 XP_019163663.1 PREDICTED: GATA transcription factor 16-like [Ipo... 56 2e-07 KZV44144.1 GATA transcription factor 15-like [Dorcoceras hygrome... 55 2e-07 XP_015087494.1 PREDICTED: GATA transcription factor 23-like [Sol... 55 3e-07 CDP20385.1 unnamed protein product [Coffea canephora] 55 3e-07 XP_008797400.1 PREDICTED: GATA transcription factor 15-like [Pho... 53 2e-06 CDP16433.1 unnamed protein product [Coffea canephora] 53 2e-06 XP_017699606.1 PREDICTED: GATA transcription factor 15-like isof... 53 2e-06 >XP_017233942.1 PREDICTED: GATA transcription factor 15-like [Daucus carota subsp. sativus] KZN04940.1 hypothetical protein DCAR_005777 [Daucus carota subsp. sativus] Length = 131 Score = 74.7 bits (182), Expect(2) = 3e-22 Identities = 39/55 (70%), Positives = 42/55 (76%) Frame = +2 Query: 128 NEVERSVEVMRLIALGKEMGLKISATTKFGXXXXXXXXXXXXSCGSLASMLDEMP 292 NEVERSV+VMRLIALG+EMGLKISAT KFG SCGSLAS+LDEMP Sbjct: 77 NEVERSVKVMRLIALGREMGLKISATAKFGEEEEAAILLMALSCGSLASVLDEMP 131 Score = 57.8 bits (138), Expect(2) = 3e-22 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GPSGPKSLCNACGIKYNKKRRQLLG Sbjct: 35 GPSGPKSLCNACGIKYNKKRRQLLG 59 >XP_016477352.1 PREDICTED: GATA transcription factor 17-like [Nicotiana tabacum] Length = 82 Score = 59.7 bits (143), Expect = 2e-09 Identities = 29/50 (58%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG*RDQENIG*RR---SRRRVVMKLKD 143 GP+GPKSLCNACGIKYNKKRRQLLG ++ ++ S ++V K+KD Sbjct: 31 GPAGPKSLCNACGIKYNKKRRQLLGLDKGRSVSKKKRKISGEKIVEKIKD 80 >XP_006359887.1 PREDICTED: GATA transcription factor 23-like [Solanum tuberosum] Length = 106 Score = 60.1 bits (144), Expect = 2e-09 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG*RDQENIG*RRSRRRVVMKL 137 GPSGPKSLCNACGIKYNKKRRQ+LG + I + + R + KL Sbjct: 32 GPSGPKSLCNACGIKYNKKRRQILGVEKKRRIVCKEEKSREIGKL 76 >XP_016478905.1 PREDICTED: GATA transcription factor 16-like [Nicotiana tabacum] Length = 117 Score = 57.8 bits (138), Expect = 2e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG*RDQENIG*RRSRRRV 125 GP+GPKSLCNACGIKYNKKRRQLLG D+E + +R++ Sbjct: 33 GPAGPKSLCNACGIKYNKKRRQLLG-LDKERSDKGKKKRKI 72 >XP_012837472.1 PREDICTED: GATA transcription factor 15-like [Erythranthe guttata] Length = 130 Score = 57.8 bits (138), Expect = 3e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GPSGPKSLCNACGIKYNKKRRQLLG Sbjct: 38 GPSGPKSLCNACGIKYNKKRRQLLG 62 >EPS59020.1 hypothetical protein M569_15793, partial [Genlisea aurea] Length = 87 Score = 56.6 bits (135), Expect = 3e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 18 GPAGPKSLCNACGIKYNKKRRQLLG 42 >XP_004247383.1 PREDICTED: GATA transcription factor 23-like [Solanum lycopersicum] Length = 103 Score = 57.0 bits (136), Expect = 3e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GPSGPKSLCNACGIKYNKKRRQ+LG Sbjct: 32 GPSGPKSLCNACGIKYNKKRRQILG 56 >XP_016567982.1 PREDICTED: GATA transcription factor 16-like [Capsicum annuum] Length = 119 Score = 57.4 bits (137), Expect = 3e-08 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 4/50 (8%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLL----G*RDQENIG*RRSRRRVVMKLK 140 GPSGPKSLCNACGIKYNKKRRQ+L G + ++ I ++ R+ M LK Sbjct: 37 GPSGPKSLCNACGIKYNKKRRQILGLDKGEKKKKKISEDKNNRKSGMSLK 86 >XP_019263042.1 PREDICTED: GATA transcription factor 16-like [Nicotiana attenuata] OIT07928.1 gata transcription factor 16 [Nicotiana attenuata] Length = 110 Score = 56.6 bits (135), Expect = 6e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 31 GPAGPKSLCNACGIKYNKKRRQLLG 55 >XP_009599707.1 PREDICTED: GATA transcription factor 16-like [Nicotiana tomentosiformis] Length = 114 Score = 56.6 bits (135), Expect = 6e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 31 GPAGPKSLCNACGIKYNKKRRQLLG 55 >XP_009758127.1 PREDICTED: GATA transcription factor 16-like [Nicotiana sylvestris] Length = 117 Score = 56.6 bits (135), Expect = 7e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 33 GPAGPKSLCNACGIKYNKKRRQLLG 57 >XP_011082433.1 PREDICTED: GATA transcription factor 15-like [Sesamum indicum] Length = 130 Score = 56.6 bits (135), Expect = 9e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 38 GPAGPKSLCNACGIKYNKKRRQLLG 62 >XP_011079598.1 PREDICTED: GATA transcription factor 15-like [Sesamum indicum] XP_011079599.1 PREDICTED: GATA transcription factor 15-like [Sesamum indicum] Length = 130 Score = 56.6 bits (135), Expect = 9e-08 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQLLG Sbjct: 38 GPAGPKSLCNACGIKYNKKRRQLLG 62 >XP_019163663.1 PREDICTED: GATA transcription factor 16-like [Ipomoea nil] Length = 139 Score = 55.8 bits (133), Expect = 2e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRRQ+LG Sbjct: 36 GPAGPKSLCNACGIKYNKKRRQMLG 60 >KZV44144.1 GATA transcription factor 15-like [Dorcoceras hygrometricum] Length = 131 Score = 55.5 bits (132), Expect = 2e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP GPKSLCNACGIKYNKKRRQL+G Sbjct: 38 GPEGPKSLCNACGIKYNKKRRQLMG 62 >XP_015087494.1 PREDICTED: GATA transcription factor 23-like [Solanum pennellii] Length = 105 Score = 54.7 bits (130), Expect = 3e-07 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GPSGPKSLCNACGIKY KKRRQ+LG Sbjct: 32 GPSGPKSLCNACGIKYTKKRRQILG 56 >CDP20385.1 unnamed protein product [Coffea canephora] Length = 147 Score = 55.5 bits (132), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG 77 GP+GPKSLCNACGIKYNKKRR+LLG Sbjct: 48 GPAGPKSLCNACGIKYNKKRRELLG 72 >XP_008797400.1 PREDICTED: GATA transcription factor 15-like [Phoenix dactylifera] Length = 138 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG*RDQENIG*RRSRRR 122 GPSGPKSLCNACGI+Y KKRR +LG ++ E RR R++ Sbjct: 41 GPSGPKSLCNACGIRYRKKRRAVLGLKEGE----RRERKQ 76 >CDP16433.1 unnamed protein product [Coffea canephora] Length = 126 Score = 52.8 bits (125), Expect = 2e-06 Identities = 25/45 (55%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG-*RDQENIG*RRSRRRVVMK 134 GP+GPKSL NACGIKYNKKRR+LLG R + + G ++ + ++V++ Sbjct: 53 GPAGPKSLYNACGIKYNKKRRELLGLDRGRNDKGKKKRKSKMVLR 97 >XP_017699606.1 PREDICTED: GATA transcription factor 15-like isoform X2 [Phoenix dactylifera] Length = 145 Score = 53.1 bits (126), Expect = 2e-06 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +3 Query: 3 GPSGPKSLCNACGIKYNKKRRQLLG*RDQENIG*RRSRRR 122 GPSGPKSLCNACGI+Y KKRR +LG ++ E RR R++ Sbjct: 41 GPSGPKSLCNACGIRYRKKRRAVLGHKEGE----RRERKQ 76