BLASTX nr result
ID: Angelica27_contig00022397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022397 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM86564.1 hypothetical protein DCAR_023698 [Daucus carota subsp... 97 9e-25 >KZM86564.1 hypothetical protein DCAR_023698 [Daucus carota subsp. sativus] Length = 82 Score = 97.1 bits (240), Expect = 9e-25 Identities = 45/61 (73%), Positives = 53/61 (86%), Gaps = 2/61 (3%) Frame = +2 Query: 68 PKSFFSWQLFSVFFILILLTSPCAATRPGRVMM--MKEVLPEMIPENMKHYQPKYEGLIS 241 PKS+ SW+L S+F ILIL TSPC ATRPGR+MM KEVLPE+IPENMKHYQP+Y+GL+S Sbjct: 4 PKSYISWKLLSIFCILILSTSPCTATRPGRMMMTTTKEVLPEIIPENMKHYQPRYQGLVS 63 Query: 242 S 244 S Sbjct: 64 S 64