BLASTX nr result
ID: Angelica27_contig00022313
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022313 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT86037.1 hypothetical protein VIGAN_04365000 [Vigna angularis ... 54 2e-06 KFQ20252.1 hypothetical protein N332_05522, partial [Mesitornis ... 52 3e-06 XP_011771777.1 hypothetical protein, unlikely [Trypanosoma bruce... 51 3e-06 XP_001746479.1 hypothetical protein [Monosiga brevicollis MX1] E... 50 5e-06 XP_009014058.1 hypothetical protein HELRODRAFT_92362, partial [H... 49 9e-06 >BAT86037.1 hypothetical protein VIGAN_04365000 [Vigna angularis var. angularis] Length = 475 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/50 (44%), Positives = 29/50 (58%) Frame = +1 Query: 85 ICCCFPARKCVCINRCIVCVSLCVFVCICRESGCVGELRCVCMVLCELCV 234 +C C CVC+ C+ CV +CV VC+C CV CVC+ +C LCV Sbjct: 84 VCVCVCVCVCVCVCVCVCCVCVCVCVCVCVCCVCVVCCVCVCVCVCVLCV 133 >KFQ20252.1 hypothetical protein N332_05522, partial [Mesitornis unicolor] Length = 190 Score = 52.4 bits (124), Expect = 3e-06 Identities = 26/51 (50%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 85 ICCCFPARKCVCINRCI-VCVSLCVFVCICRESGCVGELRCVCMVLCELCV 234 +C C P CVC+ C+ VCV LCV VC+C CV CVC+ LC LCV Sbjct: 99 VCLCVPVCVCVCLCLCVCVCVCLCVCVCVC---ACVCVPVCVCVCLC-LCV 145 >XP_011771777.1 hypothetical protein, unlikely [Trypanosoma brucei gambiense DAL972] CBH09472.1 hypothetical protein, unlikely [Trypanosoma brucei gambiense DAL972] Length = 111 Score = 50.8 bits (120), Expect = 3e-06 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = +1 Query: 85 ICCCFPARKCVCINRCI-VCVSLCVFVCIC-RESGCVGELRCVCMVLCELCV 234 +C C R CVC+ C+ VCV +CV VC+C R CV CVC+ +C +CV Sbjct: 47 VCACVCVRVCVCVRVCVCVCVCVCVCVCVCVRVCVCVCVCVCVCVCVC-VCV 97 >XP_001746479.1 hypothetical protein [Monosiga brevicollis MX1] EDQ88866.1 predicted protein [Monosiga brevicollis MX1] Length = 107 Score = 50.1 bits (118), Expect = 5e-06 Identities = 25/66 (37%), Positives = 33/66 (50%), Gaps = 6/66 (9%) Frame = +1 Query: 70 PSPSHIC-CCFPARKCVCINRCIVCVSLCVFVCIC-----RESGCVGELRCVCMVLCELC 231 P+ S +C C P +CI + VCV +CV VC+C CV CVC+ +C LC Sbjct: 40 PTASRVCVCACPVNSVLCIKKTRVCVCVCVCVCVCVCVCVCVCVCVCVCVCVCVCVCVLC 99 Query: 232 VRIQER 249 V R Sbjct: 100 VTTSNR 105 >XP_009014058.1 hypothetical protein HELRODRAFT_92362, partial [Helobdella robusta] ESO07846.1 hypothetical protein HELRODRAFT_92362, partial [Helobdella robusta] Length = 100 Score = 49.3 bits (116), Expect = 9e-06 Identities = 24/64 (37%), Positives = 30/64 (46%), Gaps = 12/64 (18%) Frame = +1 Query: 82 HICCCFPARKCVCINRCI------------VCVSLCVFVCICRESGCVGELRCVCMVLCE 225 H+C C CVC+ C+ +CVSLCV C+C CV CVC+ C Sbjct: 11 HVCACVCVCVCVCVYECMCVLHVCVCVCGCMCVSLCVRACVC---VCVCVCVCVCVCACV 67 Query: 226 LCVR 237 LC R Sbjct: 68 LCAR 71