BLASTX nr result
ID: Angelica27_contig00022215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022215 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74704.1 hypothetical protein M569_00079, partial [Genlisea au... 61 4e-10 >EPS74704.1 hypothetical protein M569_00079, partial [Genlisea aurea] Length = 88 Score = 60.8 bits (146), Expect = 4e-10 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -1 Query: 139 IVLLFPQSYGVRHRFLNKIN-SFDCMMDPPEKHWRACKRGALP 14 ++LLF QSYGVRHR ++I+ F+ MM+ PEK WRACKRGALP Sbjct: 43 VMLLFSQSYGVRHRLQDQISIDFEWMMESPEKPWRACKRGALP 85