BLASTX nr result
ID: Angelica27_contig00022190
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00022190 (261 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90258.1 hypothetical protein DCAR_022377 [Daucus carota subsp... 101 2e-23 XP_017259190.1 PREDICTED: ribosomal L1 domain-containing protein... 101 2e-23 XP_017230202.1 PREDICTED: putative ribosome biogenesis protein C... 90 3e-19 XP_017236090.1 PREDICTED: ribosomal L1 domain-containing protein... 87 3e-18 KJB33323.1 hypothetical protein B456_006G006500 [Gossypium raimo... 71 7e-13 XP_012483419.1 PREDICTED: ribosomal L1 domain-containing protein... 71 1e-12 XP_017607892.1 PREDICTED: ribosomal L1 domain-containing protein... 71 1e-12 XP_016668108.1 PREDICTED: ribosomal L1 domain-containing protein... 71 1e-12 XP_016718712.1 PREDICTED: ribosomal L1 domain-containing protein... 71 1e-12 XP_009138946.1 PREDICTED: ribosomal L1 domain-containing protein... 71 2e-12 KVI07231.1 Ribosomal protein L1 [Cynara cardunculus var. scolymus] 71 2e-12 XP_013708172.1 PREDICTED: putative ribosome biogenesis protein C... 70 2e-12 OMO88895.1 Ribosomal protein L1 [Corchorus capsularis] 70 4e-12 XP_007048483.2 PREDICTED: ribosomal L1 domain-containing protein... 70 4e-12 EOX92640.1 Ribosomal protein L1p/L10e family, putative [Theobrom... 70 4e-12 CBI31756.3 unnamed protein product, partial [Vitis vinifera] 69 7e-12 OMO56041.1 Ribosomal protein L1 [Corchorus olitorius] 69 8e-12 CAN65947.1 hypothetical protein VITISV_020727 [Vitis vinifera] 69 1e-11 XP_002283850.1 PREDICTED: ribosomal L1 domain-containing protein... 69 1e-11 XP_016539943.1 PREDICTED: ribosomal L1 domain-containing protein... 69 1e-11 >KZM90258.1 hypothetical protein DCAR_022377 [Daucus carota subsp. sativus] Length = 450 Score = 101 bits (251), Expect = 2e-23 Identities = 50/62 (80%), Positives = 54/62 (87%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 IS+AVTSLLQ Q + + QKPQLL QEQYFYLVLTLKNIPQKST TNP+KIPLPHPLIQ Sbjct: 22 ISEAVTSLLQWKQAQKSSQKPQLLAQEQYFYLVLTLKNIPQKSTGTNPHKIPLPHPLIQG 81 Query: 8 SQ 3 SQ Sbjct: 82 SQ 83 >XP_017259190.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] Length = 456 Score = 101 bits (251), Expect = 2e-23 Identities = 50/62 (80%), Positives = 54/62 (87%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 IS+AVTSLLQ Q + + QKPQLL QEQYFYLVLTLKNIPQKST TNP+KIPLPHPLIQ Sbjct: 22 ISEAVTSLLQWKQAQKSSQKPQLLAQEQYFYLVLTLKNIPQKSTGTNPHKIPLPHPLIQG 81 Query: 8 SQ 3 SQ Sbjct: 82 SQ 83 >XP_017230202.1 PREDICTED: putative ribosome biogenesis protein C8F11.04 [Daucus carota subsp. sativus] KZN10568.1 hypothetical protein DCAR_003224 [Daucus carota subsp. sativus] Length = 473 Score = 90.1 bits (222), Expect = 3e-19 Identities = 40/62 (64%), Positives = 52/62 (83%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 IS AV++LL+ +TKS +K QLLPQ+++FYL LTLK+IPQ+ R NPYKIPLPHPL+QD Sbjct: 11 ISSAVSALLKWKETKSASEKAQLLPQDEFFYLTLTLKHIPQEGRRVNPYKIPLPHPLVQD 70 Query: 8 SQ 3 S+ Sbjct: 71 SE 72 >XP_017236090.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017236091.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017236092.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017236093.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017236094.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] XP_017236095.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Daucus carota subsp. sativus] KZN04914.1 hypothetical protein DCAR_005751 [Daucus carota subsp. sativus] Length = 448 Score = 87.0 bits (214), Expect = 3e-18 Identities = 39/62 (62%), Positives = 50/62 (80%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 IS AV++LL+ +TKS +K QLLPQ +FYL LTL++IPQ+ R NPYKIPLPHPL+QD Sbjct: 11 ISSAVSALLKWKETKSASEKAQLLPQNDFFYLTLTLEHIPQEGRRVNPYKIPLPHPLVQD 70 Query: 8 SQ 3 S+ Sbjct: 71 SE 72 >KJB33323.1 hypothetical protein B456_006G006500 [Gossypium raimondii] Length = 290 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q+++ YL+++LK IPQK+ R NP K+PLPHP+I D Sbjct: 18 VEKAVNALLKWRDSQSQAQKPQLLEQDEFLYLIVSLKKIPQKA-RVNPIKVPLPHPIIDD 76 >XP_012483419.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Gossypium raimondii] KJB33322.1 hypothetical protein B456_006G006500 [Gossypium raimondii] Length = 352 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q+++ YL+++LK IPQK+ R NP K+PLPHP+I D Sbjct: 18 VEKAVNALLKWRDSQSQAQKPQLLEQDEFLYLIVSLKKIPQKA-RVNPIKVPLPHPIIDD 76 >XP_017607892.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Gossypium arboreum] Length = 353 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q+++ YL+++LK IPQK+ R NP K+PLPHP+I D Sbjct: 18 VEKAVNALLKWRDSQSQAQKPQLLEQDEFLYLIVSLKKIPQKA-RVNPIKVPLPHPIIDD 76 >XP_016668108.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Gossypium hirsutum] Length = 353 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q+++ YL+++LK IPQK+ R NP K+PLPHP+I D Sbjct: 18 VEKAVNALLKWRDSQSQAQKPQLLEQDEFLYLIVSLKKIPQKA-RVNPIKVPLPHPIIDD 76 >XP_016718712.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Gossypium hirsutum] Length = 353 Score = 71.2 bits (173), Expect = 1e-12 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q+++ YL+++LK IPQK+ R NP K+PLPHP+I D Sbjct: 18 VEKAVNALLKWRDSQSQAQKPQLLEQDEFLYLIVSLKKIPQKA-RVNPIKVPLPHPIIDD 76 >XP_009138946.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Brassica rapa] Length = 395 Score = 70.9 bits (172), Expect = 2e-12 Identities = 33/62 (53%), Positives = 46/62 (74%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + AVT+LL+ KS +KPQLL Q+++ YL++TLK IPQ + RT P++IPLPHPLI Sbjct: 26 VDTAVTALLKWRSEKSKTEKPQLLEQDEFIYLIITLKKIPQ-TNRTKPHRIPLPHPLINT 84 Query: 8 SQ 3 S+ Sbjct: 85 SE 86 >KVI07231.1 Ribosomal protein L1 [Cynara cardunculus var. scolymus] Length = 459 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/61 (52%), Positives = 45/61 (73%), Gaps = 4/61 (6%) Frame = -2 Query: 185 SKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQK----STRTNPYKIPLPHPL 18 ++AV +L++ ++S Q PQLLP++ + YL+LTLK IPQK RTNP+K+PLPHPL Sbjct: 9 TQAVDALIKWKSSQSNSQNPQLLPEDDFIYLILTLKKIPQKGGINGARTNPHKVPLPHPL 68 Query: 17 I 15 I Sbjct: 69 I 69 >XP_013708172.1 PREDICTED: putative ribosome biogenesis protein C8F11.04 [Brassica napus] CDX88996.1 BnaA04g01900D [Brassica napus] Length = 391 Score = 70.5 bits (171), Expect = 2e-12 Identities = 33/62 (53%), Positives = 46/62 (74%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + AVT+LL+ KS +KPQLL Q+++ YL++TLK IPQ + RT P++IPLPHPLI Sbjct: 26 VDTAVTALLKWRSEKSKTEKPQLLEQDEFIYLIVTLKKIPQ-TNRTKPHRIPLPHPLINT 84 Query: 8 SQ 3 S+ Sbjct: 85 SE 86 >OMO88895.1 Ribosomal protein L1 [Corchorus capsularis] Length = 353 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ +S QKPQLL ++ FYL++TLK IPQK R NP+K+PLPHPL+ Sbjct: 19 VGKAVKALLKWKDAQSNIQKPQLLGDDELFYLIVTLKKIPQK-PRVNPHKVPLPHPLLDP 77 Query: 8 S 6 S Sbjct: 78 S 78 >XP_007048483.2 PREDICTED: ribosomal L1 domain-containing protein 1 [Theobroma cacao] Length = 359 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q++ YL+++LK IPQK R NP+K+PLPHPLI Sbjct: 24 VEKAVNALLKWRDSQSHSQKPQLLEQDELLYLIVSLKKIPQK-PRVNPHKVPLPHPLIDP 82 Query: 8 S 6 S Sbjct: 83 S 83 >EOX92640.1 Ribosomal protein L1p/L10e family, putative [Theobroma cacao] Length = 359 Score = 69.7 bits (169), Expect = 4e-12 Identities = 33/61 (54%), Positives = 45/61 (73%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ ++S QKPQLL Q++ YL+++LK IPQK R NP+K+PLPHPLI Sbjct: 24 VEKAVNALLKWRDSQSHSQKPQLLEQDELLYLIVSLKKIPQK-PRVNPHKVPLPHPLIDP 82 Query: 8 S 6 S Sbjct: 83 S 83 >CBI31756.3 unnamed protein product, partial [Vitis vinifera] Length = 282 Score = 68.6 bits (166), Expect = 7e-12 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQ--YFYLVLTLKNIPQKSTRTNPYKIPLPHPL 18 I KA T+LL+ +KS QKPQLL Q++ + YL+LTLK IP K RTNP+KIPLPHPL Sbjct: 28 IEKATTALLKWQASKSNGQKPQLLNQDEDRFIYLILTLKKIPPKG-RTNPHKIPLPHPL 85 >OMO56041.1 Ribosomal protein L1 [Corchorus olitorius] Length = 302 Score = 68.6 bits (166), Expect = 8e-12 Identities = 33/61 (54%), Positives = 44/61 (72%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPLIQD 9 + KAV +LL+ +S QKPQLL ++ FYL++TLK IPQ + R NP+KIPLPHPL+ Sbjct: 17 VGKAVKALLKWKDAQSNIQKPQLLGDDELFYLIVTLKKIPQ-NPRVNPHKIPLPHPLLDP 75 Query: 8 S 6 S Sbjct: 76 S 76 >CAN65947.1 hypothetical protein VITISV_020727 [Vitis vinifera] Length = 394 Score = 68.6 bits (166), Expect = 1e-11 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQ--YFYLVLTLKNIPQKSTRTNPYKIPLPHPL 18 I KA T+LL+ +KS QKPQLL Q++ + YL+LTLK IP K RTNP+KIPLPHPL Sbjct: 12 IEKATTALLKWQASKSNGQKPQLLNQDEDRFIYLILTLKKIPPKG-RTNPHKIPLPHPL 69 >XP_002283850.1 PREDICTED: ribosomal L1 domain-containing protein 1 [Vitis vinifera] Length = 394 Score = 68.6 bits (166), Expect = 1e-11 Identities = 36/59 (61%), Positives = 44/59 (74%), Gaps = 2/59 (3%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQ--YFYLVLTLKNIPQKSTRTNPYKIPLPHPL 18 I KA T+LL+ +KS QKPQLL Q++ + YL+LTLK IP K RTNP+KIPLPHPL Sbjct: 12 IEKATTALLKWQASKSNGQKPQLLNQDEDRFIYLILTLKKIPPKG-RTNPHKIPLPHPL 69 >XP_016539943.1 PREDICTED: ribosomal L1 domain-containing protein 1-like [Capsicum annuum] Length = 424 Score = 68.6 bits (166), Expect = 1e-11 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = -2 Query: 188 ISKAVTSLLQGSQTKSTQQKPQLLPQEQYFYLVLTLKNIPQKSTRTNPYKIPLPHPL 18 + KAV +LL+ +KS QKPQLLPQ+ + YL LTLK IP K RTN Y+IP PHPL Sbjct: 21 VEKAVNALLKWKDSKSKIQKPQLLPQDDFIYLNLTLKKIPPK-PRTNAYRIPFPHPL 76