BLASTX nr result
ID: Angelica27_contig00021751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021751 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017255167.1 PREDICTED: bifunctional nuclease 1 isoform X2 [Da... 57 2e-07 XP_017255166.1 PREDICTED: bifunctional nuclease 1 isoform X1 [Da... 57 3e-07 >XP_017255167.1 PREDICTED: bifunctional nuclease 1 isoform X2 [Daucus carota subsp. sativus] Length = 279 Score = 57.0 bits (136), Expect = 2e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +1 Query: 208 MSSVQGHVIIPVAVRAKQTKVHMPPAGGPFRKYRIS 315 MSSVQGHVI PVAVRAKQTKVH PPA G RK + S Sbjct: 1 MSSVQGHVIFPVAVRAKQTKVHTPPANGLSRKCKFS 36 >XP_017255166.1 PREDICTED: bifunctional nuclease 1 isoform X1 [Daucus carota subsp. sativus] KZM90173.1 hypothetical protein DCAR_022462 [Daucus carota subsp. sativus] Length = 326 Score = 57.0 bits (136), Expect = 3e-07 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +1 Query: 208 MSSVQGHVIIPVAVRAKQTKVHMPPAGGPFRKYRIS 315 MSSVQGHVI PVAVRAKQTKVH PPA G RK + S Sbjct: 1 MSSVQGHVIFPVAVRAKQTKVHTPPANGLSRKCKFS 36