BLASTX nr result
ID: Angelica27_contig00021740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021740 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017249509.1 PREDICTED: casein kinase II subunit beta-like iso... 71 9e-13 XP_017249510.1 PREDICTED: casein kinase II subunit beta-like iso... 67 3e-11 XP_017244145.1 PREDICTED: casein kinase II subunit beta-like [Da... 58 1e-07 >XP_017249509.1 PREDICTED: casein kinase II subunit beta-like isoform X1 [Daucus carota subsp. sativus] KZM94827.1 hypothetical protein DCAR_018069 [Daucus carota subsp. sativus] Length = 224 Score = 71.2 bits (173), Expect = 9e-13 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 119 MPSTSTHKNKNKVVSEGGSETSVDESDVSGSEGEYVSWV 3 MPSTST+KNK+KVVSE SETSVDESDVSGSEGEYVSWV Sbjct: 1 MPSTSTNKNKDKVVSEEESETSVDESDVSGSEGEYVSWV 39 >XP_017249510.1 PREDICTED: casein kinase II subunit beta-like isoform X2 [Daucus carota subsp. sativus] Length = 223 Score = 67.4 bits (163), Expect = 3e-11 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -2 Query: 119 MPSTSTHKNKNKVVSEGGSETSVDESDVSGSEGEYVSWV 3 MPSTST+KNK+KVVSE SETSVDESDVSGSEGEYVSWV Sbjct: 1 MPSTSTNKNKDKVVSEE-SETSVDESDVSGSEGEYVSWV 38 >XP_017244145.1 PREDICTED: casein kinase II subunit beta-like [Daucus carota subsp. sativus] Length = 223 Score = 57.8 bits (138), Expect = 1e-07 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 119 MPSTSTHKNKNKVVSEGGSETSVDESDVSGSEGEYVSWV 3 MP TST+KNK K++S+ SETSV+ESDVSGSEG+YVSWV Sbjct: 1 MPFTSTNKNK-KLLSQEESETSVEESDVSGSEGDYVSWV 38