BLASTX nr result
ID: Angelica27_contig00021704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021704 (750 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11520.1 hypothetical protein DCAR_004176 [Daucus carota subsp... 79 7e-16 XP_017228408.1 PREDICTED: transcription factor bHLH115-like [Dau... 79 5e-14 >KZN11520.1 hypothetical protein DCAR_004176 [Daucus carota subsp. sativus] Length = 53 Score = 79.0 bits (193), Expect = 7e-16 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 159 MVLPEKNPKWMFDCGLLDDVPVPGGHPPCLDLCFQWPSNAFP 284 MV PE NP WMFDCGLLDDVPVPGGH P L+ FQWP+NAFP Sbjct: 1 MVSPENNPNWMFDCGLLDDVPVPGGHLPSLEPRFQWPTNAFP 42 >XP_017228408.1 PREDICTED: transcription factor bHLH115-like [Daucus carota subsp. sativus] Length = 235 Score = 79.0 bits (193), Expect = 5e-14 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = +3 Query: 159 MVLPEKNPKWMFDCGLLDDVPVPGGHPPCLDLCFQWPSNAFP 284 MV PE NP WMFDCGLLDDVPVPGGH P L+ FQWP+NAFP Sbjct: 1 MVSPENNPNWMFDCGLLDDVPVPGGHLPSLEPRFQWPTNAFP 42