BLASTX nr result
ID: Angelica27_contig00021547
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021547 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017230914.1 PREDICTED: uncharacterized PE-PGRS family protein... 69 4e-11 >XP_017230914.1 PREDICTED: uncharacterized PE-PGRS family protein PE_PGRS54 [Daucus carota subsp. sativus] KZN09829.1 hypothetical protein DCAR_002485 [Daucus carota subsp. sativus] Length = 480 Score = 68.6 bits (166), Expect = 4e-11 Identities = 34/45 (75%), Positives = 36/45 (80%) Frame = +1 Query: 226 DPFGSLLNFGAKQGTGMKAESKGTSNNKASSVDDGFGDFQKAPKP 360 DPFGSLLNFG K+ GMK+ESK TS NK S V DGFGDFQ APKP Sbjct: 213 DPFGSLLNFGPKKAAGMKSESKETS-NKTSLVGDGFGDFQNAPKP 256