BLASTX nr result
ID: Angelica27_contig00021156
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021156 (625 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN03372.1 hypothetical protein DCAR_012128 [Daucus carota subsp... 106 2e-26 OAY41363.1 hypothetical protein MANES_09G095800 [Manihot esculenta] 77 3e-15 XP_011006398.1 PREDICTED: uncharacterized protein LOC105112400 [... 77 6e-15 XP_002308177.1 hypothetical protein POPTR_0006s09110g [Populus t... 77 6e-15 OAY43579.1 hypothetical protein MANES_08G080600 [Manihot esculenta] 75 2e-14 XP_010043996.1 PREDICTED: uncharacterized protein LOC104433060 [... 75 2e-14 AGS78084.1 legume-specific protein [Aeschynomene virginica] 74 9e-14 AGS78076.1 legume-specific protein [Aeschynomene rudis] 74 9e-14 XP_006429167.1 hypothetical protein CICLE_v10013212mg [Citrus cl... 73 1e-13 XP_015897151.1 PREDICTED: uncharacterized protein LOC107430803 [... 73 2e-13 AGS78073.1 legume-specific protein [Aeschynomene indica] 72 4e-13 AGS78071.1 legume-specific protein [Aeschynomene indica] AGS7807... 72 4e-13 AFY13551.1 legume-specific protein [Aeschynomene evenia] AFY1355... 72 4e-13 XP_002322919.1 hypothetical protein POPTR_0016s10420g [Populus t... 72 5e-13 XP_002534277.1 PREDICTED: uncharacterized protein LOC8261800 [Ri... 72 5e-13 KYP43563.1 hypothetical protein KK1_034990 [Cajanus cajan] 72 6e-13 AGS78074.1 legume-specific protein [Aeschynomene indica] 71 7e-13 AGC95059.1 legume-specific protein [Aeschynomene ciliata] 71 7e-13 AFY13545.1 legume-specific protein [Aeschynomene evenia] AFY1354... 71 7e-13 XP_012831825.1 PREDICTED: uncharacterized protein LOC105952794 [... 70 1e-12 >KZN03372.1 hypothetical protein DCAR_012128 [Daucus carota subsp. sativus] Length = 81 Score = 106 bits (264), Expect = 2e-26 Identities = 56/82 (68%), Positives = 61/82 (74%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNGGDIGLFLNESPSASYMRLPGDSGRFQALQYXXXXXXXXXXXX 259 MEGLIPFVYRAIVQYRNGGD+G FL+ESPSA+YMRLPGDSGRFQALQ Sbjct: 1 MEGLIPFVYRAIVQYRNGGDMGSFLSESPSAAYMRLPGDSGRFQALQ-ANHRGKSPCSSP 59 Query: 260 XNATKQPVVGVEKQGIDGRVIM 325 A KQP VGV+ +GI G VIM Sbjct: 60 SKAAKQPAVGVQTRGIHGPVIM 81 >OAY41363.1 hypothetical protein MANES_09G095800 [Manihot esculenta] Length = 93 Score = 77.4 bits (189), Expect = 3e-15 Identities = 37/47 (78%), Positives = 43/47 (91%), Gaps = 2/47 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQA 214 MEGLIPFVYRAI+QY+NG G +G +LN+SPS+SYMRLPGDSGRFQA Sbjct: 1 MEGLIPFVYRAIMQYKNGNEGPLGSWLNDSPSSSYMRLPGDSGRFQA 47 >XP_011006398.1 PREDICTED: uncharacterized protein LOC105112400 [Populus euphratica] Length = 100 Score = 77.0 bits (188), Expect = 6e-15 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 3/47 (6%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG---GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVYRAI+QY+NG G +G + NESPSASYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYRAIIQYKNGKEAGPLGSWFNESPSASYMRLPGDSGRFQ 47 >XP_002308177.1 hypothetical protein POPTR_0006s09110g [Populus trichocarpa] EEE91700.1 hypothetical protein POPTR_0006s09110g [Populus trichocarpa] Length = 100 Score = 77.0 bits (188), Expect = 6e-15 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 3/47 (6%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG---GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVYRAI+QY+NG G +G + NESPSASYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYRAIIQYKNGKEAGPLGSWFNESPSASYMRLPGDSGRFQ 47 >OAY43579.1 hypothetical protein MANES_08G080600 [Manihot esculenta] Length = 97 Score = 75.5 bits (184), Expect = 2e-14 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 2/47 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQA 214 MEGLIPFVYRAI QY+NG G +G +LN+SPSASYMRLPGDS RFQA Sbjct: 1 MEGLIPFVYRAITQYKNGKEGPLGSWLNDSPSASYMRLPGDSDRFQA 47 >XP_010043996.1 PREDICTED: uncharacterized protein LOC104433060 [Eucalyptus grandis] KCW86000.1 hypothetical protein EUGRSUZ_B02706 [Eucalyptus grandis] Length = 101 Score = 75.5 bits (184), Expect = 2e-14 Identities = 38/47 (80%), Positives = 40/47 (85%), Gaps = 2/47 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQA 214 MEGLIPFVYRAIVQYRNG G + + ESPSASYMRLPGDSGRFQA Sbjct: 1 MEGLIPFVYRAIVQYRNGNQGPLATWFPESPSASYMRLPGDSGRFQA 47 >AGS78084.1 legume-specific protein [Aeschynomene virginica] Length = 89 Score = 73.6 bits (179), Expect = 9e-14 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG +++ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGSIGTWISESPSYSYMRLPGDSGRFQ 46 >AGS78076.1 legume-specific protein [Aeschynomene rudis] Length = 90 Score = 73.6 bits (179), Expect = 9e-14 Identities = 35/46 (76%), Positives = 41/46 (89%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG +++ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGSIGTWISESPSYSYMRLPGDSGRFQ 46 >XP_006429167.1 hypothetical protein CICLE_v10013212mg [Citrus clementina] XP_006493571.1 PREDICTED: uncharacterized protein LOC102615992 [Citrus sinensis] ESR42407.1 hypothetical protein CICLE_v10013212mg [Citrus clementina] KDO48147.1 hypothetical protein CISIN_1g034581mg [Citrus sinensis] Length = 90 Score = 73.2 bits (178), Expect = 1e-13 Identities = 35/46 (76%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNGGDIGL--FLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVYRAI+QY+NG +G + ESPSASYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYRAIMQYKNGNQVGFGSWYGESPSASYMRLPGDSGRFQ 46 >XP_015897151.1 PREDICTED: uncharacterized protein LOC107430803 [Ziziphus jujuba] Length = 107 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 3/48 (6%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNGGDIGL---FLNESPSASYMRLPGDSGRFQA 214 MEGLIPFVYRAIV+Y+NG L + NESPSASYMRLPGDSGRFQA Sbjct: 1 MEGLIPFVYRAIVEYKNGNKQDLLDSWFNESPSASYMRLPGDSGRFQA 48 >AGS78073.1 legume-specific protein [Aeschynomene indica] Length = 90 Score = 72.0 bits (175), Expect = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGSIGTWICESPSYSYMRLPGDSGRFQ 46 >AGS78071.1 legume-specific protein [Aeschynomene indica] AGS78075.1 legume-specific protein [Aeschynomene scabra] AGS78083.1 legume-specific protein [Aeschynomene virginica] Length = 90 Score = 72.0 bits (175), Expect = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGSIGTWICESPSYSYMRLPGDSGRFQ 46 >AFY13551.1 legume-specific protein [Aeschynomene evenia] AFY13552.1 legume-specific protein [Aeschynomene evenia] AFY13553.1 legume-specific protein [Aeschynomene evenia] AFY13554.1 legume-specific protein [Aeschynomene evenia] AFY13555.1 legume-specific protein [Aeschynomene evenia] AFY13556.1 legume-specific protein [Aeschynomene evenia] AGC95057.1 legume-specific protein [Aeschynomene evenia] AGC95058.1 legume-specific protein [Aeschynomene evenia] AGS78070.1 legume-specific protein [Aeschynomene indica] Length = 90 Score = 72.0 bits (175), Expect = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGSIGTWICESPSYSYMRLPGDSGRFQ 46 >XP_002322919.1 hypothetical protein POPTR_0016s10420g [Populus trichocarpa] EEF04680.1 hypothetical protein POPTR_0016s10420g [Populus trichocarpa] Length = 99 Score = 72.0 bits (175), Expect = 5e-13 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 3/47 (6%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG---GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVYRAI+Q+ NG G +G + +ESPSASYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYRAIMQFNNGKEAGPLGSWFSESPSASYMRLPGDSGRFQ 47 >XP_002534277.1 PREDICTED: uncharacterized protein LOC8261800 [Ricinus communis] EEF28108.1 conserved hypothetical protein [Ricinus communis] Length = 106 Score = 72.0 bits (175), Expect = 5e-13 Identities = 37/48 (77%), Positives = 42/48 (87%), Gaps = 3/48 (6%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLP-GDSGRFQA 214 MEGLIPFVYRAI+QY+NG G +G +LNESPS+ YMRLP GDSGRFQA Sbjct: 1 MEGLIPFVYRAIMQYKNGNEGPLGSWLNESPSSCYMRLPTGDSGRFQA 48 >KYP43563.1 hypothetical protein KK1_034990 [Cajanus cajan] Length = 95 Score = 71.6 bits (174), Expect = 6e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG +L ESPS SYM+LPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIIQYKNGKQGPIGSWLCESPSYSYMKLPGDSGRFQ 46 >AGS78074.1 legume-specific protein [Aeschynomene indica] Length = 90 Score = 71.2 bits (173), Expect = 7e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGAIGTWICESPSYSYMRLPGDSGRFQ 46 >AGC95059.1 legume-specific protein [Aeschynomene ciliata] Length = 90 Score = 71.2 bits (173), Expect = 7e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGAIGTWICESPSYSYMRLPGDSGRFQ 46 >AFY13545.1 legume-specific protein [Aeschynomene evenia] AFY13546.1 legume-specific protein [Aeschynomene evenia] AFY13547.1 legume-specific protein [Aeschynomene evenia] AFY13548.1 legume-specific protein [Aeschynomene evenia] AFY13549.1 legume-specific protein [Aeschynomene evenia] AFY13550.1 legume-specific protein [Aeschynomene evenia] Length = 91 Score = 71.2 bits (173), Expect = 7e-13 Identities = 35/46 (76%), Positives = 40/46 (86%), Gaps = 2/46 (4%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNG--GDIGLFLNESPSASYMRLPGDSGRFQ 211 MEGLIPFVY+AI+QY+NG G IG ++ ESPS SYMRLPGDSGRFQ Sbjct: 1 MEGLIPFVYKAIMQYKNGNEGAIGTWICESPSYSYMRLPGDSGRFQ 46 >XP_012831825.1 PREDICTED: uncharacterized protein LOC105952794 [Erythranthe guttata] EYU41761.1 hypothetical protein MIMGU_mgv1a017291mg [Erythranthe guttata] Length = 83 Score = 70.5 bits (171), Expect = 1e-12 Identities = 36/44 (81%), Positives = 40/44 (90%), Gaps = 1/44 (2%) Frame = +2 Query: 80 MEGLIPFVYRAIVQYRNGGDIGLFLNESPSASYMRLP-GDSGRF 208 MEGLIPFVY+AIVQY+NGG G +LNESPSASYMR+P GDSGRF Sbjct: 1 MEGLIPFVYKAIVQYKNGGR-GTWLNESPSASYMRIPAGDSGRF 43