BLASTX nr result
ID: Angelica27_contig00021138
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021138 (280 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI04426.1 Ran GTPase [Cynara cardunculus var. scolymus] 86 2e-18 XP_017246784.1 PREDICTED: ras-related protein Rab11D [Daucus car... 83 2e-17 KZM91335.1 hypothetical protein DCAR_021300 [Daucus carota subsp... 78 3e-17 ABF70133.1 GTP-binding protein, putative [Musa balbisiana] 78 3e-17 GAU26631.1 hypothetical protein TSUD_102390 [Trifolium subterran... 78 4e-17 OMP02604.1 Small GTPase superfamily [Corchorus olitorius] 77 2e-16 XP_018857123.1 PREDICTED: ras-related protein Rab11D [Juglans re... 79 3e-16 CDP15958.1 unnamed protein product [Coffea canephora] 79 3e-16 XP_019450009.1 PREDICTED: ras-related protein Rab11D-like [Lupin... 79 5e-16 XP_013641609.1 PREDICTED: ras-related protein RABA1b-like [Brass... 76 6e-16 Q40194.1 RecName: Full=Ras-related protein Rab11D CAA98180.1 RAB... 79 6e-16 BAH56989.1 AT1G06400 [Arabidopsis thaliana] 75 7e-16 JAU54348.1 Ras-related protein RABA1b, partial [Noccaea caerules... 79 7e-16 JAU05328.1 Ras-related protein RABA1b, partial [Noccaea caerules... 79 7e-16 XP_006305559.1 hypothetical protein CARUB_v10010133mg, partial [... 79 7e-16 CAN60629.1 hypothetical protein VITISV_018876 [Vitis vinifera] 75 7e-16 XP_016676016.1 PREDICTED: ras-related protein RABA1f-like isofor... 75 8e-16 KMT13080.1 hypothetical protein BVRB_4g086220 [Beta vulgaris sub... 78 8e-16 XP_006388146.1 hypothetical protein POPTR_0312s00200g, partial [... 75 8e-16 XP_009416427.1 PREDICTED: ras-related protein Rab11D isoform X3 ... 78 9e-16 >KVI04426.1 Ran GTPase [Cynara cardunculus var. scolymus] Length = 245 Score = 85.5 bits (210), Expect = 2e-18 Identities = 41/42 (97%), Positives = 41/42 (97%) Frame = +2 Query: 155 EMSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 EMS YRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 27 EMSAYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 68 >XP_017246784.1 PREDICTED: ras-related protein Rab11D [Daucus carota subsp. sativus] KZM99357.1 hypothetical protein DCAR_013281 [Daucus carota subsp. sativus] Length = 217 Score = 82.8 bits (203), Expect = 2e-17 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 MS YRTEDEYDYLFKLV+IGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MSAYRTEDEYDYLFKLVIIGDSGVGKSNLLSRFTRNEFNLE 41 >KZM91335.1 hypothetical protein DCAR_021300 [Daucus carota subsp. sativus] Length = 74 Score = 78.2 bits (191), Expect = 3e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ Y+ EDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAGYKAEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >ABF70133.1 GTP-binding protein, putative [Musa balbisiana] Length = 75 Score = 78.2 bits (191), Expect = 3e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ED+YDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAGYRAEDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >GAU26631.1 hypothetical protein TSUD_102390 [Trifolium subterraneum] Length = 79 Score = 78.2 bits (191), Expect = 4e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR +DEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAGYRADDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >OMP02604.1 Small GTPase superfamily [Corchorus olitorius] Length = 94 Score = 76.6 bits (187), Expect = 2e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ Y+ ED+YDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAGYKPEDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >XP_018857123.1 PREDICTED: ras-related protein Rab11D [Juglans regia] Length = 217 Score = 79.3 bits (194), Expect = 3e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+VY+ ED+YDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAVYKPEDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >CDP15958.1 unnamed protein product [Coffea canephora] Length = 218 Score = 79.3 bits (194), Expect = 3e-16 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR EDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAGYRAEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >XP_019450009.1 PREDICTED: ras-related protein Rab11D-like [Lupinus angustifolius] OIW08308.1 hypothetical protein TanjilG_02984 [Lupinus angustifolius] Length = 218 Score = 79.0 bits (193), Expect = 5e-16 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+VY+ +DEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MAVYKGDDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 41 >XP_013641609.1 PREDICTED: ras-related protein RABA1b-like [Brassica napus] Length = 106 Score = 75.9 bits (185), Expect = 6e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 1 MAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLE 41 >Q40194.1 RecName: Full=Ras-related protein Rab11D CAA98180.1 RAB11D [Lotus japonicus] Length = 218 Score = 78.6 bits (192), Expect = 6e-16 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M YRT+DEYDYLFKLVLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 1 MGGYRTDDEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLE 41 >BAH56989.1 AT1G06400 [Arabidopsis thaliana] Length = 97 Score = 75.5 bits (184), Expect = 7e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ++EYDYLFKLVLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 1 MAGYRADEEYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLE 41 >JAU54348.1 Ras-related protein RABA1b, partial [Noccaea caerulescens] Length = 241 Score = 79.0 bits (193), Expect = 7e-16 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +2 Query: 128 EPRRGSRKVEMSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 E ++ EM+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 16 EEKQPPETAEMAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLE 66 >JAU05328.1 Ras-related protein RABA1b, partial [Noccaea caerulescens] Length = 241 Score = 79.0 bits (193), Expect = 7e-16 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +2 Query: 128 EPRRGSRKVEMSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 E ++ EM+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 16 EEKQPPETAEMAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLE 66 >XP_006305559.1 hypothetical protein CARUB_v10010133mg, partial [Capsella rubella] EOA38457.1 hypothetical protein CARUB_v10010133mg, partial [Capsella rubella] Length = 243 Score = 79.0 bits (193), Expect = 7e-16 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = +2 Query: 128 EPRRGSRKVEMSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 E ++ EM+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 18 EEKQPPETAEMAGYRVEDDYDYLFKVVLIGDSGVGKSNLLSRFTKNEFNLE 68 >CAN60629.1 hypothetical protein VITISV_018876 [Vitis vinifera] Length = 87 Score = 75.1 bits (183), Expect = 7e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFTRNEF+LE Sbjct: 1 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLE 41 >XP_016676016.1 PREDICTED: ras-related protein RABA1f-like isoform X2 [Gossypium hirsutum] Length = 88 Score = 75.1 bits (183), Expect = 8e-16 Identities = 34/41 (82%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR +D+YDYLFK+VLIGDSGVGKSNLLSRFTRNEF+LE Sbjct: 1 MAAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLE 41 >KMT13080.1 hypothetical protein BVRB_4g086220 [Beta vulgaris subsp. vulgaris] Length = 211 Score = 78.2 bits (191), Expect = 8e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 MS YR +D+YDYLFK+VLIGDSGVGKSNLLSRFTRNEFNLE Sbjct: 1 MSAYRADDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLE 41 >XP_006388146.1 hypothetical protein POPTR_0312s00200g, partial [Populus trichocarpa] ERP47060.1 hypothetical protein POPTR_0312s00200g, partial [Populus trichocarpa] Length = 92 Score = 75.1 bits (183), Expect = 8e-16 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ED+YDYLFK+VLIGDSGVGKSNLLSRFTRNEF+LE Sbjct: 1 MAGYRAEDDYDYLFKVVLIGDSGVGKSNLLSRFTRNEFSLE 41 >XP_009416427.1 PREDICTED: ras-related protein Rab11D isoform X3 [Musa acuminata subsp. malaccensis] Length = 215 Score = 78.2 bits (191), Expect = 9e-16 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +2 Query: 158 MSVYRTEDEYDYLFKLVLIGDSGVGKSNLLSRFTRNEFNLE 280 M+ YR ED+YDYLFKLVLIGDSGVGKSNLLSRFT+NEFNLE Sbjct: 1 MAAYRAEDDYDYLFKLVLIGDSGVGKSNLLSRFTKNEFNLE 41