BLASTX nr result
ID: Angelica27_contig00021064
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00021064 (292 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN07155.1 hypothetical protein DCAR_007992 [Daucus carota subsp... 54 3e-06 XP_017233900.1 PREDICTED: cysteine-rich receptor-like protein ki... 54 3e-06 >KZN07155.1 hypothetical protein DCAR_007992 [Daucus carota subsp. sativus] Length = 647 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 292 VMPPKPFLYPQADTTEINNSTYISPNLQQDED 197 VMPPKPFLYPQ DTTEI+N + SPNL DED Sbjct: 616 VMPPKPFLYPQEDTTEIDNPIHSSPNLLPDED 647 >XP_017233900.1 PREDICTED: cysteine-rich receptor-like protein kinase 19 [Daucus carota subsp. sativus] XP_017233901.1 PREDICTED: cysteine-rich receptor-like protein kinase 19 [Daucus carota subsp. sativus] Length = 661 Score = 53.9 bits (128), Expect = 3e-06 Identities = 24/32 (75%), Positives = 26/32 (81%) Frame = -1 Query: 292 VMPPKPFLYPQADTTEINNSTYISPNLQQDED 197 VMPPKPFLYPQ DTTEI+N + SPNL DED Sbjct: 630 VMPPKPFLYPQEDTTEIDNPIHSSPNLLPDED 661