BLASTX nr result
ID: Angelica27_contig00018909
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018909 (283 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248899.1 PREDICTED: ankyrin and armadillo repeat-containin... 71 3e-12 >XP_017248899.1 PREDICTED: ankyrin and armadillo repeat-containing protein [Daucus carota subsp. sativus] KZM93114.1 hypothetical protein DCAR_016359 [Daucus carota subsp. sativus] Length = 548 Score = 70.9 bits (172), Expect = 3e-12 Identities = 36/56 (64%), Positives = 38/56 (67%) Frame = +1 Query: 25 MKVSEDEDINNINHLIQSLLSSIPNAQTFKGKWSSIAXXXXXXXXXXXXXXXFPAN 192 MKVSE+EDINNI HL+QSLLSSIP AQ FKGKWSSIA FPAN Sbjct: 1 MKVSEEEDINNIKHLVQSLLSSIPKAQIFKGKWSSIAEKLSDLNLHLSDLSDFPAN 56