BLASTX nr result
ID: Angelica27_contig00018862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018862 (521 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KDO42102.1 hypothetical protein CISIN_1g034193mg [Citrus sinensis] 54 2e-06 XP_017215247.1 PREDICTED: vacuolar protein sorting-associated pr... 54 4e-06 >KDO42102.1 hypothetical protein CISIN_1g034193mg [Citrus sinensis] Length = 101 Score = 53.9 bits (128), Expect = 2e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -2 Query: 520 AILVSSGIVLQVLACAMYHNWWLMLTGK*ELLYL 419 AILVS GIVLQ+LACA+Y+NWW MLTGK L++ Sbjct: 21 AILVSGGIVLQILACALYNNWWPMLTGKPHELFV 54 >XP_017215247.1 PREDICTED: vacuolar protein sorting-associated protein 55 homolog [Daucus carota subsp. sativus] Length = 139 Score = 53.9 bits (128), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -2 Query: 520 AILVSSGIVLQVLACAMYHNWWLMLT 443 AILVSSGIVLQVLACA+YHNWW MLT Sbjct: 21 AILVSSGIVLQVLACALYHNWWPMLT 46