BLASTX nr result
ID: Angelica27_contig00018748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018748 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN02323.1 hypothetical protein DCAR_011077 [Daucus carota subsp... 82 8e-16 XP_017239776.1 PREDICTED: ARF guanine-nucleotide exchange factor... 82 8e-16 XP_017241590.1 PREDICTED: ARF guanine-nucleotide exchange factor... 69 4e-11 KZN03115.1 hypothetical protein DCAR_011871 [Daucus carota subsp... 69 5e-11 >KZN02323.1 hypothetical protein DCAR_011077 [Daucus carota subsp. sativus] Length = 1424 Score = 82.4 bits (202), Expect = 8e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 245 MGCPSHHPEINSYGRGFDDCSSRPSGGAFALTVNSEISAVLAVM 376 MGC SH PE+NS+GRGFDDCSSRPSGGAFAL VNSEI AVLAVM Sbjct: 1 MGCLSHQPEVNSFGRGFDDCSSRPSGGAFALIVNSEIGAVLAVM 44 >XP_017239776.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Daucus carota subsp. sativus] Length = 1427 Score = 82.4 bits (202), Expect = 8e-16 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = +2 Query: 245 MGCPSHHPEINSYGRGFDDCSSRPSGGAFALTVNSEISAVLAVM 376 MGC SH PE+NS+GRGFDDCSSRPSGGAFAL VNSEI AVLAVM Sbjct: 1 MGCLSHQPEVNSFGRGFDDCSSRPSGGAFALIVNSEIGAVLAVM 44 >XP_017241590.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Daucus carota subsp. sativus] XP_017241591.1 PREDICTED: ARF guanine-nucleotide exchange factor GNOM-like [Daucus carota subsp. sativus] Length = 1447 Score = 68.9 bits (167), Expect = 4e-11 Identities = 33/45 (73%), Positives = 35/45 (77%) Frame = +2 Query: 242 IMGCPSHHPEINSYGRGFDDCSSRPSGGAFALTVNSEISAVLAVM 376 +MGCP NS GRGFD CSS P+GGAFALTVNSEI AVLAVM Sbjct: 1 MMGCPCDQSNSNSIGRGFDGCSSSPAGGAFALTVNSEIGAVLAVM 45 >KZN03115.1 hypothetical protein DCAR_011871 [Daucus carota subsp. sativus] Length = 1446 Score = 68.6 bits (166), Expect = 5e-11 Identities = 33/44 (75%), Positives = 34/44 (77%) Frame = +2 Query: 245 MGCPSHHPEINSYGRGFDDCSSRPSGGAFALTVNSEISAVLAVM 376 MGCP NS GRGFD CSS P+GGAFALTVNSEI AVLAVM Sbjct: 1 MGCPCDQSNSNSIGRGFDGCSSSPAGGAFALTVNSEIGAVLAVM 44