BLASTX nr result
ID: Angelica27_contig00018724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018724 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM99061.1 hypothetical protein DCAR_013577 [Daucus carota subsp... 58 4e-09 >KZM99061.1 hypothetical protein DCAR_013577 [Daucus carota subsp. sativus] Length = 58 Score = 57.8 bits (138), Expect = 4e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 215 ILILAIVSGATAVSAQLAPAPSPDVGASFALPV 117 I++LAIVS A AVSAQLAPAPSPDVGASFALPV Sbjct: 7 IIMLAIVSSAVAVSAQLAPAPSPDVGASFALPV 39