BLASTX nr result
ID: Angelica27_contig00018708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00018708 (253 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM85647.1 hypothetical protein DCAR_026931 [Daucus carota subsp... 74 4e-14 XP_017222727.1 PREDICTED: SWI/SNF-related matrix-associated acti... 72 6e-14 XP_017221743.1 PREDICTED: SWI/SNF-related matrix-associated acti... 72 1e-13 XP_017222729.1 PREDICTED: SWI/SNF-related matrix-associated acti... 72 5e-13 >KZM85647.1 hypothetical protein DCAR_026931 [Daucus carota subsp. sativus] Length = 237 Score = 73.9 bits (180), Expect = 4e-14 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = -1 Query: 244 PSSSPGKQKTLDSFVKRCSNIQKHEEEPNAKQARH 140 PSSSPGKQKTLDSFVKRC+NIQKHE+EPNAKQARH Sbjct: 202 PSSSPGKQKTLDSFVKRCTNIQKHEDEPNAKQARH 236 >XP_017222727.1 PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 homolog [Daucus carota subsp. sativus] KZM85642.1 hypothetical protein DCAR_026936 [Daucus carota subsp. sativus] KZM85648.1 hypothetical protein DCAR_026930 [Daucus carota subsp. sativus] Length = 182 Score = 72.4 bits (176), Expect = 6e-14 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 244 PSSSPGKQKTLDSFVKRCSNIQKHEEEPNAKQARH 140 PSSSPGKQKTLDSFVKRC+NIQKH++EPNAKQARH Sbjct: 147 PSSSPGKQKTLDSFVKRCNNIQKHKDEPNAKQARH 181 >XP_017221743.1 PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 [Daucus carota subsp. sativus] Length = 235 Score = 72.4 bits (176), Expect = 1e-13 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 244 PSSSPGKQKTLDSFVKRCSNIQKHEEEPNAKQARH 140 PSSSPGKQKTLDSFVKRC+NIQKH++EPNAKQARH Sbjct: 200 PSSSPGKQKTLDSFVKRCNNIQKHKDEPNAKQARH 234 >XP_017222729.1 PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 [Daucus carota subsp. sativus] Length = 677 Score = 72.4 bits (176), Expect = 5e-13 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 244 PSSSPGKQKTLDSFVKRCSNIQKHEEEPNAKQARH 140 PSSSPGKQKTLDSFVKRC+NIQKH++EPNAKQARH Sbjct: 642 PSSSPGKQKTLDSFVKRCNNIQKHKDEPNAKQARH 676