BLASTX nr result
ID: Angelica27_contig00017983
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica27_contig00017983 (511 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017257688.1 PREDICTED: calcineurin B-like protein 7 isoform X... 59 1e-07 XP_017257686.1 PREDICTED: calcineurin B-like protein 7 isoform X... 59 2e-07 XP_017257685.1 PREDICTED: calcineurin B-like protein 7 isoform X... 59 2e-07 XP_017257683.1 PREDICTED: calcineurin B-like protein 7 isoform X... 59 2e-07 XP_010267625.1 PREDICTED: calcineurin B-like protein 7 [Nelumbo ... 56 2e-06 XP_015069154.1 PREDICTED: calcineurin B-like protein 7 [Solanum ... 55 3e-06 XP_006350549.1 PREDICTED: calcineurin B-like protein 7 [Solanum ... 55 3e-06 NP_001234705.1 calcium sensor calcineurin B-like [Solanum lycope... 55 3e-06 KCW89144.1 hypothetical protein EUGRSUZ_A01457 [Eucalyptus grandis] 54 9e-06 >XP_017257688.1 PREDICTED: calcineurin B-like protein 7 isoform X4 [Daucus carota subsp. sativus] XP_017257689.1 PREDICTED: calcineurin B-like protein 7 isoform X4 [Daucus carota subsp. sativus] XP_017257690.1 PREDICTED: calcineurin B-like protein 7 isoform X4 [Daucus carota subsp. sativus] XP_017257691.1 PREDICTED: calcineurin B-like protein 7 isoform X4 [Daucus carota subsp. sativus] KZM92313.1 hypothetical protein DCAR_020322 [Daucus carota subsp. sativus] Length = 220 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFVLNSEVPDSEV Sbjct: 193 NMTLPYLKDITLAFPSFVLNSEVPDSEV 220 >XP_017257686.1 PREDICTED: calcineurin B-like protein 7 isoform X3 [Daucus carota subsp. sativus] Length = 247 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFVLNSEVPDSEV Sbjct: 220 NMTLPYLKDITLAFPSFVLNSEVPDSEV 247 >XP_017257685.1 PREDICTED: calcineurin B-like protein 7 isoform X2 [Daucus carota subsp. sativus] Length = 248 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFVLNSEVPDSEV Sbjct: 221 NMTLPYLKDITLAFPSFVLNSEVPDSEV 248 >XP_017257683.1 PREDICTED: calcineurin B-like protein 7 isoform X1 [Daucus carota subsp. sativus] XP_017257684.1 PREDICTED: calcineurin B-like protein 7 isoform X1 [Daucus carota subsp. sativus] Length = 254 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFVLNSEVPDSEV Sbjct: 227 NMTLPYLKDITLAFPSFVLNSEVPDSEV 254 >XP_010267625.1 PREDICTED: calcineurin B-like protein 7 [Nelumbo nucifera] XP_010267626.1 PREDICTED: calcineurin B-like protein 7 [Nelumbo nucifera] Length = 219 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV*TGAR 99 NMTLPYLKDITLAFPSFV+NSEV DSE+ T A+ Sbjct: 186 NMTLPYLKDITLAFPSFVVNSEVEDSEMVTNAQ 218 >XP_015069154.1 PREDICTED: calcineurin B-like protein 7 [Solanum pennellii] Length = 214 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFV+NSEV DSEV Sbjct: 187 NMTLPYLKDITLAFPSFVMNSEVEDSEV 214 >XP_006350549.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] XP_006350550.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] XP_015165622.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] XP_015165623.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] XP_015165624.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] XP_015165625.1 PREDICTED: calcineurin B-like protein 7 [Solanum tuberosum] Length = 214 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFV+NSEV DSEV Sbjct: 187 NMTLPYLKDITLAFPSFVMNSEVEDSEV 214 >NP_001234705.1 calcium sensor calcineurin B-like [Solanum lycopersicum] CAG30525.1 calcium sensor calcineurin B-like protein [Solanum lycopersicum] BAL04560.1 calcineurin B-like molecule [Solanum lycopersicum] Length = 214 Score = 55.5 bits (132), Expect = 3e-06 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFV+NSEV DSEV Sbjct: 187 NMTLPYLKDITLAFPSFVMNSEVEDSEV 214 >KCW89144.1 hypothetical protein EUGRSUZ_A01457 [Eucalyptus grandis] Length = 205 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/28 (92%), Positives = 26/28 (92%) Frame = +1 Query: 1 NMTLPYLKDITLAFPSFVLNSEVPDSEV 84 NMTLPYLKDITLAFPSFVL SEV DSEV Sbjct: 178 NMTLPYLKDITLAFPSFVLRSEVEDSEV 205